KEGG   Rattus norvegicus (rat): 362275
Entry
362275            CDS       T01003                                 

Gene name
B4galt5
Definition
(RefSeq) beta-1,4-galactosyltransferase 5
  KO
K09905  beta-1,4-galactosyltransferase 5 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00512  Mucin type O-glycan biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    362275 (B4galt5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    362275 (B4galt5)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     362275 (B4galt5)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   362275 (B4galt5)
SSDB
Motif
Pfam: Glyco_transf_7N
Other DBs
NCBI-GeneID: 362275
NCBI-ProteinID: NP_001102078
RGD: 1310062
Ensembl: ENSRNOG00000008283
UniProt: F1LZL3
Position
3
AA seq 143 aa
MVQAQGILLRDNVRTIGAQVYEQVVRSAYAKRNSSLNDSDYPLDLNHSEAFPPTTTFLPE
DFTYFANHPCPERLPSMKGPIDINMSEIRMDDIHELFSRDPAIRLGGHWKPADCMPRWKV
AILIPFRNRHDSFLCLPPCSLCP
NT seq 432 nt   +upstreamnt  +downstreamnt
atggtgcaggctcaaggcatcctgcttcgggacaacgtgaggaccatcggtgcccaggtg
tatgagcaggtggtccgcagcgcctacgccaagaggaacagcagcctgaatgactcagat
tatcctctggacttgaaccacagtgaagcctttcccccaaccacaacatttcttcctgaa
gatttcacctattttgccaaccacccttgcccggagaggctcccttccatgaagggcccg
atagacataaacatgagtgagatcagaatggacgatattcatgagctcttctccagagac
ccggccatcaggcttggaggacactggaagcctgcagactgcatgcctcggtggaaggtg
gccatcctcatccctttccggaaccgccacgactccttcctgtgtctgcctccctgcagc
ctctgtccctga

DBGET integrated database retrieval system