KEGG   Rattus norvegicus (rat): 362293
Entry
362293            CDS       T01003                                 

Gene name
Dnajb6
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member B6
  KO
K09512  DnaJ homolog subfamily B member 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    362293 (Dnajb6)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP40 / DNAJ
   362293 (Dnajb6)
SSDB
Motif
Pfam: DnaJ
Other DBs
NCBI-GeneID: 362293
NCBI-ProteinID: NP_001013227
RGD: 1308207
Ensembl: ENSRNOG00000010353
UniProt: Q6AYU3
Position
4q11
AA seq 357 aa
MVDYYEVLGVQRHASPEDIKKAYRKQALKWHPDKNPENKEEAERKFKQVAEAYEVLSDAK
KRDIYDKYGKEGLNGGGGGGGSHFDSPFEFGFTFRNPDDVFREFFGGRDPFSFDFFEDPF
DDFFGNRRGPRGSRSRGAGSFFSAFSGFPSFGSGFPAFDTGFTPFGSLGHGGLTSFSSAS
FGGSGMGNFKSISTSTKIVNGKKITTKRIVENGQERVEVEEDGQLKSLTINGVADENALA
EECRRRGQPTPALAPGPAPAPARVPSQARPPTPAPTPAPAQTPAPSVSTRPQKPPRPAPT
AKLVSKSNWEDEEQDRQRVPGNCDAPMTSAGLKEGGKRKKQKQKEDSKKKKSTKGNH
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggtggattactatgaagtgctgggcgtgcagagacatgcctcacctgaggacattaaa
aaggcgtatcgaaaacaggcactcaaatggcacccagacaaaaatcctgaaaataaagaa
gaagcggagcggaaattcaaacaagtagctgaggcatatgaagtgttatcggatgctaaa
aagcgggacatctatgacaaatatggcaaagaaggattaaatggtggtggaggaggaggt
ggaagtcattttgacagtccatttgagtttggcttcacattccggaacccagatgatgtc
ttcagggaattttttggtggaagggacccattttcatttgacttctttgaagatccattt
gatgacttttttggaaaccgaaggggtccccgaggaagtagaagccgaggtgctggctcc
tttttctccgccttcagtggatttccttcttttggaagtggatttcctgcttttgataca
ggctttactccattcgggtcactaggtcatgggggtctcacttcattttcttcagcgtca
tttggcggcagtggaatgggcaacttcaaatcaatatcaacttcaactaaaatagttaat
ggcaaaaaaatcactacaaagagaattgtggagaacggtcaggaaagagtagaagttgaa
gaagacggacagttaaagtccctgacgataaatggtgtggccgacgagaacgcccttgca
gaagaatgccggcggagaggccaacccacaccagctctggcccctggcccggccccagca
ccagcccgggtcccctctcaggcccgacccccgaccccagctcccaccccagctccagcc
cagactccagccccttctgtcagcacccgcccacagaagccacccaggcctgccccaacg
gccaaacttgtgtctaaaagcaactgggaagatgaagagcaggacaggcagcgggttcct
ggcaactgtgatgcccctatgacctcagcagggctcaaagaaggtggcaagaggaagaag
cagaagcagaaagaggactcgaagaagaagaagtcgaccaaagggaaccactag

DBGET integrated database retrieval system