KEGG   Rattus norvegicus (rat): 362316
Entry
362316            CDS       T01003                                 

Gene name
Cdk14, Pftk1
Definition
(RefSeq) cyclin-dependent kinase 14
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    362316 (Cdk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    362316 (Cdk14)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     362316 (Cdk14)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDK family
   362316 (Cdk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Seadorna_VP7
Other DBs
NCBI-GeneID: 362316
NCBI-ProteinID: NP_001102087
RGD: 1305544
Ensembl: ENSRNOG00000007151
UniProt: D3ZSZ0
Position
4q13
AA seq 279 aa
MQQYTKGKASKLTSLLKGLKHANIVLLHDIIHTKETLTLVFEYVLFLFQLLRGLSYIHQR
YILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYS
TCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPER
FTVYSSKSLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFSDLPPRLWELT
DMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
NT seq 840 nt   +upstreamnt  +downstreamnt
atgcaacagtatacaaagggaaaagcaagtaagttaacttctctgctgaaaggattaaag
catgcaaacatcgtgcttcttcatgacatcatccacaccaaggaaacactgacacttgtc
tttgaatatgtgttgtttttatttcagttgctgcgagggctgtcttacatccaccagcgt
tatattttgcacagagacctgaaaccgcagaaccttctcatcagtgacacgggggagttg
aagctggcagatttcggtctggcaagagcaaaatccgtccctagccacacgtactccaat
gaagtggttaccttgtggtacagacctccagacgttctcctgggctctacagagtactcc
acctgcctggacatgtggggagtcggctgtatctttgttgagatgatccaaggagtcgct
gcatttccaggaatgaaagacattcaggatcaacttgaacggatatttctggttcttgga
acaccaaacgaggacacgtggcctggagttcattctttaccacattttaagccagaacga
tttaccgtgtacagctctaaaagccttagacaagcatggaataagctcagctatgtaaat
cacgccgaggacctggcctccaagcttctacagtgttccccaaagaacaggctgtcagca
caggccgccttgagccacgagtatttcagcgatctgcccccgcggctatgggagctgacc
gatatgtcttctatttttactgtcccaaatgtgagattgcaacccgaagctggagagagc
atgagggcctttggaaaaaacaatagttacgggaaaagtctatcgaacagcaagcactga

DBGET integrated database retrieval system