KEGG   Rattus norvegicus (rat): 362320
Entry
362320            CDS       T01003                                 

Gene name
Fam133b, RGD1306302
Definition
(RefSeq) family with sequence similarity 133, member B
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 362320
NCBI-ProteinID: NP_001019970
RGD: 1306302
Ensembl: ENSRNOG00000009163
UniProt: Q505I5
Position
4q13
AA seq 245 aa
MGKRDNRVAYMNPIAMARSRGPIQSSGPTIQDYLNRPRPTWEEVKEQLEKKKKGSKALAE
FEEKMNENWKKELEKHREKLLSGNESSSKKRQKKKKEKKKSGRYSSSSSSSSDSSSSSSD
SEEEDKKQTKRRKKKKSHCHKSPETSVSDSDSDSKDGSKKKKKSKDITEREKDTKGLSKK
RKMYEDKPLSSESLSESDCGEVQAKKKKSGEERERTTDKAKKRRKHKKHSKKKKKKAASS
SSDSP
NT seq 738 nt   +upstreamnt  +downstreamnt
atggggaagcgagacaatcgcgtggcctacatgaatccaatagcaatggctcggtcaagg
ggtccaatccagtcttcaggaccaacaatccaggattatctgaatcgaccaaggcctacc
tgggaggaagtgaaggagcagctggaaaagaaaaagaagggctccaaggctttggctgag
tttgaagagaaaatgaatgagaattggaagaaagaactagaaaaacatagagaaaaacta
ttaagtggaaatgagagctcatccaaaaagcgacagaaaaagaaaaaagaaaagaagaaa
tctggtaggtattcatcttcttcttcatcgagctctgattcttccagcagttcttcagat
tctgaggaggaggataaaaagcaaacaaaaagaaggaagaaaaagaagagccattgccat
aagtctccggagacctccgtgtcggattcagactcagacagcaaggatggttcaaaaaag
aaaaagaagtcaaaggatataactgaaagagaaaaggacactaaaggactcagcaaaaag
agaaagatgtatgaggataaacctttgtcatctgagtcattgtcagagtcagactgtgga
gaggtgcaagcgaaaaagaagaaaagcggtgaagagcgagagagaacaacagacaaagct
aaaaagagaaggaagcataagaaacacagcaagaagaagaaaaagaaggctgccagttca
agctcagactcgccgtag

DBGET integrated database retrieval system