KEGG   Rattus norvegicus (rat): 362329Help
Entry
362329            CDS       T01003                                 

Gene name
Impdh1, IMPD_1, IMPDH_1
Definition
(RefSeq) inosine monophosphate dehydrogenase 1
  KO
K00088  IMP dehydrogenase [EC:1.1.1.205]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Module
rno_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    362329 (Impdh1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    362329 (Impdh1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    362329 (Impdh1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.205  IMP dehydrogenase
     362329 (Impdh1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   362329 (Impdh1)
  Exosomal proteins of breast cancer cells
   362329 (Impdh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMPDH NMO FMN_dh CBS His_biosynth NanE ThiG Glu_synthase DHO_dh PcrB G3P_antiterm
Motif
Other DBs
NCBI-GeneID: 362329
NCBI-ProteinID: NP_001102089
RGD: 1311108
Ensembl: ENSRNOG00000020032
UniProt: A0A0A0MXZ8
Position
4q22
AA seq 548 aa AA seqDB search
MEEPLSPPPESGLLSPLLQGGGAAAAPEPGARQHPGHETAAQRYSARLLQAGYEPESMAD
YLISGGTGYVPEDGLTAQQLFANADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKT
PLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSP
SHTVGDVLEAKIQHGFSGIPITATGTMGSKLVMTPRIELVVAPAGVTLKEANEILQRSKK
GKLPIVNDQDELVAIIARTDLKKNRDYPLASKDSHKQLLCGAAVGTREDDKYRLDLLTQA
GADVIVLDSSQGNSVYQIAMVHYIKQKYPHLQVIGGNVVTAAQAKNLIDAGVDGLRVGMG
CGSICITQEVMACGRPQGTAVYKVAEYARRFGVPVIADGGIQTVGHVVKALALGASTVMM
GSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGS
IQDKGSIQKFVPYLIAGIQHGCQDIGAQSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGL
HSYEKRLY
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaccgctctcacccccaccggagtccgggctactctcgccgctgctgcaggga
ggcggagccgctgctgctccagagcccggagcccggcaacacccgggacatgagaccgcg
gcgcagcggtacagcgcccgcctgctgcaggccggctacgagccggagagcatggcggac
tacctgatcagcggcggcaccggctacgttcccgaggatgggctcaccgcgcagcagctc
ttcgccaacgcggatggcctcacctacaacgatttcctgatcctcccaggattcatagac
ttcatagctgatgaagtggacctgacatcagccctgacccggaagatcacactgaagaca
ccactgatctcgtctcccatggataccgtgacagaggctgacatggccattgcaatggct
ctcatgggaggaattggtttcattcaccacaactgtaccccagagttccaggccaatgag
gtgcggaaggtcaagaagtttgagcaaggcttcatcacagaccctgtggtcctgagccct
tcacataccgtgggtgatgttctggaggccaagatacagcatggcttctctggtatccct
atcaccgcaacgggcaccatggggagcaagctggtgatgacgccgaggatcgagctggtg
gtggctccagcaggtgtgacattgaaagaggcaaatgagattttgcagcgcagcaagaaa
gggaagctgcccatagtcaacgatcaagacgagctggtagccattattgcacgcacagac
ctgaagaagaacagagactaccctctggcctccaaagactcccacaaacagctgttgtgt
ggggcagctgtgggcacccgtgaggatgacaaataccgtctggatttgctcactcaggcc
ggtgctgacgtcatagtactagattcatcccaggggaactcagtatatcagatcgccatg
gtgcactatatcaagcagaagtacccccacctccaggtgattgggggaaacgtggtgaca
gcggcccaggccaagaacttgatcgatgccggtgtggatgggcttcgtgtgggcatgggc
tgtggctccatctgcatcactcaggaagtgatggcctgtggccgaccccagggcactgct
gtctacaaggtggctgagtatgcccggcgctttggggtgccggtaatagctgatggtggt
atccagactgtgggccatgtggtcaaagccctggcgctcggagcctctacagtgatgatg
ggctccttgctggctgctaccacggaggcccctggtgaatacttcttctcagacggggtg
aggcttaagaagtaccgaggcatgggttccctggacgccatggagaagagcagcagcagc
cagaagcgatacttcagtgagggggacaaagtgaagatcgcacagggtgtctcgggctcc
atccaggataaaggctccattcagaagtttgtgccctacctcatagcagggatccagcat
ggctgtcaggatattggggcccaaagcctgtctgtcctgcgatccatgatgtactcagga
gagctcaagtttgagaagcggaccatgtcagcccagatagagggcggtgtgcacggccta
cactcttacgagaagcggctgtactga

DBGET integrated database retrieval system