KEGG   Rattus norvegicus (rat): 362336Help
Entry
362336            CDS       T01003                                 

Gene name
Fam180a, RGD1308013
Definition
(RefSeq) family with sequence similarity 180, member A
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: FAM180
Motif
Other DBs
NCBI-GeneID: 362336
NCBI-ProteinID: NP_001102091
RGD: 1308013
Ensembl: ENSRNOG00000011750
UniProt: D3Z9K6
Position
4q22
AA seq 172 aa AA seqDB search
MPWKVLTILLVLSSAQATACRWSRAALFPAAHRPKRSLSLPLNPVLQTSLEEVELLYELL
LAEIEISPDLKISIKDEELASLRKALNFHSICNNIIPKSIPDIRRLSANLANNPGVLKKE
DFERIALTLAYTAYRTALSEGHQKDIWAQSLISLFQALRHDLMRSSSPGVPS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccctggaaggtgctgacgattctgctggtgctctccagcgcccaggccactgcgtgc
aggtggagcagggctgcactgttcccagctgcccatcggccaaagaggtccttgtccctg
ccattgaatccagtcctgcagacctccctggaggaggtggaactgctgtatgagctcttg
ctagctgaaattgagatcagcccagacctgaagatctccatcaaggatgaggagctggct
tccctgcggaaggccttgaatttccactcaatctgcaacaacataatccccaagagtatc
ccagatattcgaaggctgagtgccaacctggcaaacaaccctggggtcctcaagaaagaa
gactttgaaaggatagccttaaccctggcttacacagcctatcgaaccgccttatctgaa
ggacaccagaaggacatctgggcccaatccctcatcagcctattccaggccctgaggcat
gacttgatgaggtcctcaagccctggagtgccttcctga

DBGET integrated database retrieval system