KEGG   Rattus norvegicus (rat): 362343Help
Entry
362343            CDS       T01003                                 

Gene name
Parp12, Zc3hdc1
Definition
(RefSeq) poly (ADP-ribose) polymerase family, member 12
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    362343 (Parp12)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     362343 (Parp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE HTH_53 zf-CCCH zf-CCCH_4 zf_CCCH_4 zf-CCCH_8 Torus
Motif
Other DBs
NCBI-GeneID: 362343
NCBI-ProteinID: XP_003749764
RGD: 1308628
Ensembl: ENSRNOG00000008196
UniProt: D4A3V3
Position
4q22
AA seq 706 aa AA seqDB search
MAQAAVAVAEVTQLLCAAGGALELAELRRRLRTSLGADALERLLRDRGRFVVASREGTGP
ATAAAAASERVVVAVSSLRLCRAHQGPKQGCTGLCAQLHLCKFLIYGNCKFLRTGKNCRN
GHNLKTDHNLSVLRTHGIDHLTYTELCQLLLQNDPSLLPDICLHYNKGDGHFGSCSFQKQ
CIKLHICQYFLQGECKFGTSCKRSHEFTNSENLEKLEKLGLSSDLVSRLLSTYRNAYDIK
NKGSALSKVSSSPAGPQGTSERKDSSVSPGTLSQEESEQICLYHIRKSCSFQDKCHRVHF
HLPYRWQFLDGGEWKDLDNMELIENAYCNPSKDRIVYTESAAGFHFDNLDFNSMKLGHTL
ARRLSTASSVTKPPHFILTTEWAWYWMDEFGSWQEYGRQGTGHPVTTISSSDVEKAYLSF
CVPGADAQAAILKFQAGKHNYELDFKAFLQKNLVYGTVRKVCRRPKYVSPQDVQMKQSCN
TKLHGTKSIPDYWDPAALPDLGFKRITLSSSSEEYQKVWNLFNRTLPFYFVQKIERIQNL
GLWEVYQWQKGQMQKQNGGKEVDERQLFHGTSTNFVDAICQQNFDWRVCGLHGTSYGKGS
YFARDAAYSHHYSKSDTHSHTMFLARVLVGDFVRGSTSFVRPPAKEGQSNAFYDSCVNSM
SDPTIFVVFEKHQVYPEYLIQYSTSSKPPAGPSIFVALGNLFTSRQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggccgcggtggcggtggcagaggtgacccagttgctgtgcgcggcggggggc
gccttggagttggcggagctgaggcgccgcttgcgaaccagcctgggcgccgacgcgctg
gagcggctgctgcgggaccgcgggcgcttcgtggtggcctcgcgggagggcacgggcccg
gcgaccgcggcggcggcggcctcggagcgcgtggtagtggctgtgtcgtcgctgcgtctg
tgccgcgcgcaccagggccccaagcagggctgcaccgggctctgcgcgcagttgcatctc
tgcaagtttctcatctacggtaactgcaagttcctgaggaccgggaagaactgtaggaat
ggtcacaacttgaagactgatcacaacctgagtgtgctgaggactcatggtattgaccac
ctcacgtatactgagctttgccaactcttacttcagaatgacccttcgcttttaccagat
atctgcctacactataacaaaggtgatggacacttcggctcttgctccttccagaagcag
tgcattaaactccatatctgccagtacttcttacagggagagtgcaagtttggcactagc
tgtaagaggtcccacgagttcactaactcagagaatctggagaaattagaaaagttgggt
ttaagttctgacctggtgagcaggctactctctacttaccggaatgcatatgacatcaag
aataagggctcagccctcagcaaagtgtcctcttctcctgcaggcccacaggggacttct
gaaagaaaagacagttcagtgtccccaggcactcttagccaggaggagagtgagcagatt
tgcttgtaccatattcggaagagttgtagcttccaagataagtgccatcgggtacatttt
catttgccatatcggtggcaattcttggatggaggtgaatggaaggatctggacaacatg
gagcttattgaaaatgcttattgcaatcccagtaaagacaggattgtatacacagagtca
gccgctggcttccactttgataatctggactttaactccatgaagcttggtcacactctg
gctcgccgactctccacagcttcctcggtcaccaagcccccacacttcatcctcactact
gagtgggcttggtactggatggatgagtttggttcttggcaggagtacggacgacagggc
acagggcaccctgtgaccaccatcagcagcagtgatgtggaaaaggcttacttgtcattc
tgtgttccgggggctgatgcccaggcagccatcttgaagttccaggctggaaagcacaac
tatgagttagacttcaaagcctttctgcagaagaaccttgtgtatggcactgtcagaaag
gtttgtcgcagacccaagtatgtgtctccccaggatgtgcagatgaagcagtcctgcaat
actaagttacacggcacgaagagcattccagactactgggaccctgcagccctgccggac
ctgggatttaagaggatcactctgagttcctcctcagaagagtatcagaaggtatggaac
ctcttcaaccgtacactacctttctactttgttcagaagatcgagcggatccagaacctg
ggcctgtgggaagtctaccagtggcagaaaggccagatgcagaagcagaatggggggaag
gaagtagatgagaggcagctgtttcatgggactagcaccaacttcgtggacgccatctgc
cagcagaactttgactggcgggtctgtggtctgcacggtacatcctatggcaaagggagc
tactttgcgagagatgccgcctattcgcaccactacagcaaatctgacacacactcccac
accatgttcctggcccgggtgctggtgggagacttcgtcaggggcagcacttcctttgtc
cgccctccagccaaggaaggccagagcaatgctttctatgacagctgcgtgaacagcatg
tccgacccgactatctttgtagtttttgagaagcaccaggtctaccctgagtacctcatc
caatactctacctcctccaagcccccagctggcccctccatctttgttgccctgggcaac
ttgttcaccagccgacagtaa

DBGET integrated database retrieval system