KEGG   Rattus norvegicus (rat): 362344
Entry
362344            CDS       T01003                                 

Gene name
Ndufb2
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B2
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00190  Oxidative phosphorylation
rno01100  Metabolic pathways
rno04714  Thermogenesis
rno04723  Retrograde endocannabinoid signaling
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05012  Parkinson disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05020  Prion disease
rno05022  Pathways of neurodegeneration - multiple diseases
Module
rno_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    362344 (Ndufb2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    362344 (Ndufb2)
  09159 Environmental adaptation
   04714 Thermogenesis
    362344 (Ndufb2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    362344 (Ndufb2)
   05012 Parkinson disease
    362344 (Ndufb2)
   05014 Amyotrophic lateral sclerosis
    362344 (Ndufb2)
   05016 Huntington disease
    362344 (Ndufb2)
   05020 Prion disease
    362344 (Ndufb2)
   05022 Pathways of neurodegeneration - multiple diseases
    362344 (Ndufb2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    362344 (Ndufb2)
SSDB
Motif
Pfam: NADH_B2
Other DBs
NCBI-GeneID: 362344
NCBI-ProteinID: NP_001102094
RGD: 1308130
Ensembl: ENSRNOG00000026616
UniProt: B2RYU0
Position
4q22
AA seq 105 aa
MSALARLAPFGRVGGRLLRGCRARAAGDGGVRHVGDGGHIQPRYREFPQLTQSQVIHGEV
LSSLMWFWILWRFWHDSDAVLGHFSYPDPSKWTDEELGVPPDDED
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtctgcgctggcccgcctggcacctttcggtcgcgttggaggccgcctgcttcggggc
tgccgcgcgcgggcagctggagacggtggagtccgtcatgttggcgatggtggacacatt
cagccccggtacagggagtttccccagcttacccagtcccaggtgatccatggtgaggtc
ttaagctcactcatgtggttctggattctttggagattttggcatgactcggatgctgtg
ctgggtcacttttcatatccagatccatcgaagtggacagatgaagaactgggggtccct
cctgacgacgaggactga

DBGET integrated database retrieval system