KEGG   Rattus norvegicus (rat): 362360Help
Entry
362360            CDS       T01003                                 

Gene name
Osbpl3, RGD1564287
Definition
(RefSeq) oxysterol binding protein-like 3
  KO
K20463  oxysterol-binding protein-related protein 3/6/7
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362360 (Osbpl3)
Membrane trafficking [BR:rno04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Oxysterol-binding proteins
    362360 (Osbpl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxysterol_BP PH_8 PH
Motif
Other DBs
NCBI-GeneID: 362360
NCBI-ProteinID: XP_001055606
RGD: 1564287
Ensembl: ENSRNOG00000010011
UniProt: D3ZHZ3
Position
4q24
AA seq 886 aa AA seqDB search
MSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMTYTQEPPAQKGFLLKK
RKWPLKGWHKRFFCLEKGILKYAKSQTDIEREKLHGSIDVGLSVMSVKKSSKCIDLDTEE
HIYHLKVKSEDVFDEWVSKLRHHRMYRQNEIAMFPRDVNHFFPGSSVTDSAPGVFESVSS
RKRSSLSKQNSFPAGSNLSFSCGGDTRVPFWLQSSEDMEKCSKDLAHCHTYLLEMSQLLE
SMDVLHRTYSAPAINAIQGGAFESPKKEKRSHRRWRSRAIGKDAKGMLQVPKPFSGPVRL
HSSNPNLSTLDFGEEKSYSDGSEASSEFSKMQEDLCHVAHKVYFALRSAFNSISMEREKL
KQLMELDTSSSPSAQVVGLKHALSSALAQNTDLKERLRRIHAESLLLDPPAGPKPGDNLA
EEISRDESRALVHQLSNESRLSITDSLSEFFDAQEVLLSPSSSENEISDDDSYVSDISDN
LSLDNLSNDLDNERQTLGPVLESSGEARSKRRTSLPAPGPNTSSVSVWSILRNNIGKDLS
KVAMPVELNEPLNTLQRLCEELEYSELLDKAAHMPSPLERMVYVAAFAISAYASSYFRAG
SKPFNPVLGETYECIRQDKGFQFFAEQVSHHPPISACHAESRNFVFWQDVRWKNKFWGKS
MEIVPIGTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIVIKNLRDDSCHCKVN
FIKAKYWSTNAHEIEGTVFDRSGKAVHRLFGKWHESIYCGGASSSTCVWRANPMPKGYEQ
YYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQRLLEEGNIEEAEVQKQRIEKLQRERRR
VLEENGVEHQPRFFRKSSDDAWVSNGTYLELRKDLGFSKLDHPVLW
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgagaagaatctgggtgtgtcccaaaagttggtttcaccctcaagaagcaca
agtagctgttcctccaagcaaggaagccggcaggacagctgggaagtggtggaaggattg
agaggggagatgacttacacccaggagccgcctgcgcagaaaggatttttgctgaaaaag
aggaagtggcccttaaaaggctggcacaagagattcttctgcctggaaaagggaatcttg
aaatatgccaagagccaaactgatattgagagagagaagctgcacggcagtattgacgtg
gggctctccgtgatgtctgtgaagaagtcatccaaatgtatagacctcgacaccgaggag
cacatctaccacctgaaggtaaagtcagaagacgtctttgacgagtgggtgtccaagctt
cgtcaccacagaatgtaccggcagaatgagatcgccatgtttccccgggatgtcaaccac
tttttcccagggtcctctgtcacagactctgctccgggagtattcgagtctgtttccagt
aggaagcgcagcagtctatcaaagcagaattcatttccagctggaagcaatttgtcattt
tcttgtggtggggacacacgagttccattctggctacagtcttcagaggacatggaaaag
tgctcgaaagacttggcacactgccacacttatctgctggagatgagccagctcttagaa
agcatggacgtcttgcatcggacatactcggcgccagctatcaacgccatccagggtgga
gcttttgaaagtcccaaaaaggaaaagcgctcgcacaggaggtggcggtccagagctatt
ggcaaagatgctaaaggaatgctgcaggtccctaaacctttttctggcccggtgagactg
cactcctccaatcctaacttgtcaacactggactttggagaagagaagtcttactcggat
ggttctgaagcctcgtcggagttctccaagatgcaggaggacctgtgccatgtcgcccat
aaagtttacttcgctttaaggtcagctttcaatagcatatcgatggagagagagaagttg
aagcagctgatggaactggacacctcctcctccccttctgctcaggtcgtcggtctgaag
catgccctgtcatccgccctagcacaaaacacagatcttaaagaacgtttacgcagaatc
catgcagagtctctgctcctcgacccgcctgctggtcccaaaccgggggacaacctggca
gaggaaatctccagggatgaaagccgagccctggtacaccagctctccaacgagagcagg
ctgtccatcaccgactccctttctgagtttttcgatgcccaggaagttctgctatctcct
agctcttcagaaaacgagatctctgatgatgattcatacgtcagtgacataagtgataat
ctgtccttagacaacctcagtaacgatttagacaatgaaagacagaccttgggtcctgtt
ctcgaaagtagtggggaagccaggtccaaaaggcggaccagcctgccagcgccgggaccc
aacaccagtagcgtgagtgtgtggagcatcctgcgcaacaacattgggaaggacctgtcc
aaggtggccatgccggtagagctgaacgagcccctgaacacactgcagcggctctgcgag
gagctagaatacagcgagcttctggacaaggctgcgcacatgcccagtcccctggagagg
atggtatacgtggcagccttcgccatctctgcatatgcatccagctacttccgggcaggc
agcaagccatttaacccggtccttggagaaacgtacgaatgcatccgacaggacaagggt
ttccagttttttgccgagcaggtcagccaccacccgcctatctccgcctgccacgccgag
tcccggaactttgttttctggcaagacgtgagatggaaaaacaaattctggggtaaatcc
atggaaattgtcccgattggtactacccatgtgactctgcctgcgtttggagatcacttc
gagtggaacaaagtgacctcctgcatccacaacatcttaagcggacagcgctggatcgag
cactatggtgaaattgtcatcaagaacctgagagacgactcctgccactgcaaagtgaac
ttcataaaggcaaaatactggagcactaatgcccatgagatcgaaggcacggtattcgac
cgcagtgggaaggctgtgcaccggctgtttggaaaatggcatgagagcatctactgtggc
ggtgcctcctcctccacgtgtgtctggagagcaaatcccatgccgaaaggctatgagcag
tattatggcttcacacagtttgcattagagttaaatgaaatggatcctttgtcaaggtct
ttattaccacccaccgacactcgttttagaccagatcaaaggcttctagaagaaggaaac
atagaggaggctgaggtgcagaagcagaggattgagaagctgcagagggagaggcggagg
gtcctggaggaaaacggtgtggagcaccagccccggtttttcaggaaatccagtgacgat
gcttgggtgagcaacgggacctatctggaactgaggaaagaccttggcttttccaagctg
gaccatcccgtcttgtggtga

DBGET integrated database retrieval system