KEGG   Rattus norvegicus (rat): 362364
Entry
362364            CDS       T01003                                 

Gene name
Tril, RGD1310827
Definition
(RefSeq) TLR4 interactor with leucine-rich repeats
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_9 LRR_1 LRR_5 LRRCT CopD fn3
Other DBs
NCBI-GeneID: 362364
NCBI-ProteinID: NP_001029182
RGD: 1310827
Ensembl: ENSRNOG00000026941
UniProt: Q496Z2
Position
4q24
AA seq 811 aa
MEGVGAVRFWLVVCGCLAFPPRAESVCPERCDCQHPQHLLCTNRGLRAVPKTSSLPSPQD
VLTYSLGGNFITNITAFDFHRLGQLRRLDLQYNQIRSLHPKTFEKLSRLEELYLGNNLLQ
ALAPGTLAPLRKLRILYANGNEIGRLSRGSFEGLESLVKLRLDGNVLGALPDAVFAPLGN
LLYLHLEANRIRFLGKNAFTQLGKLRFLNLSANELQPSLRHAATFVPLRSLSTLILSANS
LQHLGPRVFQHLPRLGLLSLSGNQLTHLAPEAFWGLEALRELRLEGNRLNQLPLTLLEPL
HSLEALDLSGNELSALHPATFGHQGRLRELSLRDNALSALSGDIFAASPALYRLDLDGNG
WTCDCRLRGLKRWMGNWHSQGRLLTVFVQCRHPPALRGKYLDYLDDQLLQNGSCVDPSPS
PTAGSRQWPISTAPGEGMTPPAGLAQELPLQPQPQPQQRGRLLPGVAWAGAAKELVGNRS
ALRLNRRGPGLQHQSPSAAAASGSAPQSLDLHEKPERGRPTRANLPQTEPTPTSEPASGT
PSARDSWQRAAKQRLASEQQGRAVQYDSGVGLPPLVSDPCDFNKFILCNLTVEAVSANSA
SVRWAVREHRSPRPQGGARFRLLFDRFGQQPKFQRFVYLPERSDSATLHELRGDTPYLVC
VEGVLGGRVCPVAPRDHCAGLVTLPEAGGRGGVDYQLLTLVLLAINALLVLLALAAWGSR
WLRRKLRARRKGGAPVHVRHMYSTRRPLRSMGTGVSADFSGFQSHRPRTTVCALSEADLI
EFPCDRFMDSSGGGTGGSLRREDHLLQRFAD
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggagggtgtgggcgccgtgcgcttctggctcgtggtgtgcggctgcctggctttcccg
ccgcgggccgagtcggtgtgtccggagcgctgcgactgccagcacccccagcatctcctg
tgcaccaacagggggcttcgcgcggtgcccaagaccagctcgctgcctagtccccaggac
gtgctcacctacagcctaggcggcaacttcatcaccaacatcaccgccttcgacttccat
cgcctggggcagctcagacggctggatctgcagtacaaccagatccgctctctccacccc
aagaccttcgagaagctctccagactagaggagctgtacctggggaacaacctcttgcag
gcgctcgctcctggcacgttggccccgctgcgcaaattgcgcatcctttacgccaacggt
aacgagattggacgcctgagtcgcggctccttcgagggcctggagagtctagtcaagcta
cggctggacgggaacgtgctgggagcgctgccggacgcggtcttcgctcctctgggcaac
ctgctctacctacatctggaggctaaccggatccgctttttgggcaagaacgccttcacc
cagctgggtaagcttcgattcctcaatctctctgccaacgagctgcaaccctctctgcgg
cacgcggccacctttgtccctctgcgctccctctctactctcatcctctctgccaacagc
ctgcagcacctaggcccccgcgtcttccagcacctgccacgcctaggcctgctctccctc
agcggcaaccagctcacccacctcgccccagaggccttctgggggctggaggccctgcgt
gagctgcgcctggaaggcaaccggctgaaccagctgcccctgaccctgctggagcctctg
cacagcttggaagcactagatctgagcggcaatgagctttctgctctgcatcccgccacc
tttggccaccaaggccgcctacgtgagctcagcctgcgcgacaatgcgctcagcgccctt
tctggagacatcttcgccgccagtccggctctctaccggctagatctagacggcaacggt
tggacctgcgactgccggttgcggggtctgaaacgctggatgggcaactggcattctcag
ggtcgcctccttacggtcttcgtgcagtgtcgccaccccccggccctgcggggcaagtac
ctggattacctggatgaccaactgctgcagaatgggtcttgcgtggatccctccccttcc
cctacagcaggcagtaggcagtggccgatatccactgcgccaggggaggggatgacgccc
cctgcaggtctcgcgcaggagctgccactgcagccacagccgcagccccagcagcggggg
agacttctaccaggagtggcctgggctggggctgccaaggagctggtgggcaaccgcagc
gcattaaggttgaaccggcggggtccaggcctgcagcatcagagcccctctgccgctgct
gcttcgggttctgccccacagtccttggacctgcacgagaagccagagcgaggacgtccc
acccgagcaaatctcccccagacggagcccaccccgacgtctgagcccgcctctgggaca
ccatctgccagagacagctggcagcgcgcagcaaagcagcgcctcgcttcagagcagcaa
gggcgtgccgtccagtacgatagtggcgtcggcttgccacctctggtgtctgacccctgt
gacttcaataaattcattctatgcaacctgaccgtagaggcagtgagcgccaacagcgcc
tcggtgcgctgggccgttcgagagcatcgcagtccccggccgcagggcggcgcacgcttc
cgcctgcttttcgatcgctttggccagcagcccaagttccagcgctttgtctacctgcca
gaacgcagcgactcggccacgctgcacgagctgcgcggagacaccccgtacctagtgtgc
gtggagggcgtgctcgggggtcgcgtttgccccgtggccccccgagaccactgcgcaggg
ttggtaaccctgccagaggcaggaggtagaggtggcgtcgactaccagctactgaccttg
gtcttgctggctatcaacgcgctgctggtgctcctggcactggcggcctggggatcccga
tggctgaggaggaagctgcgtgccaggcggaagggaggggccccggtccacgttcgccac
atgtactccacccgacggccactgcgctccatgggcactggtgtgtccgcggacttctca
ggcttccagtcacaccgtccccgcaccaccgtgtgcgcgctcagcgaggcggacctcatt
gagttcccctgcgaccgcttcatggacagctccggtggtgggaccggtggcagcttgagg
cgggaggaccacctcttgcaaagatttgctgactag

DBGET integrated database retrieval system