KEGG   Rattus norvegicus (rat): 362366Help
Entry
362366            CDS       T01003                                 

Gene name
Fkbp14
Definition
(RefSeq) FK506 binding protein 14
  KO
K09577  FK506-binding protein 14 [EC:5.2.1.8]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    362366 (Fkbp14)
Enzymes [BR:rno01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     362366 (Fkbp14)
Chaperones and folding catalysts [BR:rno03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    362366 (Fkbp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 362366
NCBI-ProteinID: NP_001013228
RGD: 1311705
Ensembl: ENSRNOG00000009886
UniProt: Q5XID8
Position
4q24
AA seq 211 aa AA seqDB search
MRFFLWNANLTLWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLTIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKHEVKVYLQNEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYVHDEL
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttttcttgtggaatgcgaacttgacactgtgggtcacggttttgagtggagct
ctgatccccgagccagaagtgaagatcgaagttcttcagaaaccattcatctgccatcgc
aagaccaagggaggggatctgatgttggtccactacgaaggctatttagaaaaggatggc
tccctgtttcattccactcacaaacataacaatggccagcccgtctggttcaccctgggc
atactggaggttctcaaaggctgggaccaaggcttgaagggaatgtgtgtgggagagaag
cgaaagctcaccattcctcctgccctgggctatggcaaagaaggaaaaggtaaaataccc
ccagagagcacactgatattcaacattgacctcctggaaattcgaaatggcccaaggtcc
cacgaatcatttcaagaaatggatctcaacgacgactggaaactctctaagcacgaggtg
aaagtctatttacagaatgagtttgagaagcacggtgcagtggtgaatgaaagccatcac
gatgctttggtggaagatatttttgataaagaagatgaagacaaagatgggtttatatct
gccagagaatttacatatgtgcatgacgaactgtag

DBGET integrated database retrieval system