KEGG   Rattus norvegicus (rat): 362368
Entry
362368            CDS       T01003                                 

Gene name
Ggct
Definition
(RefSeq) gamma-glutamylcyclotransferase
  KO
K00682  gamma-glutamylcyclotransferase [EC:4.3.2.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00480  Glutathione metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    362368 (Ggct)
Enzymes [BR:rno01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.9  gamma-glutamylcyclotransferase
     362368 (Ggct)
SSDB
Motif
Pfam: AIG2_2 GGACT
Other DBs
NCBI-GeneID: 362368
NCBI-ProteinID: NP_001102099
RGD: 1304876
Ensembl: ENSRNOG00000034084
UniProt: D3ZPV8
Position
4
AA seq 188 aa
MASSDCEDHAGQEGETFLYFAYGSNLLTERIHLRNPSAVFCCVARLQDFKLDFGNFQGKM
SERWHGGIATIFQSPGDEVWGVVWKMNKSNLSSLDEQEGVKSGVYVVIEIKVTTQQGKDI
TCRSYLMTNYERAPPSPQYKKVICMGAKENGLPLEYQEKLNVIEPNDYKGKISDEMEDII
KKGEAKLL
NT seq 567 nt   +upstreamnt  +downstreamnt
atggcgagctccgactgtgaggaccatgcgggtcaggagggggagacgttcctgtacttc
gcctacggcagcaatctgctgaccgagaggatccacctgcgaaacccttccgccgtgttc
tgctgcgtggcgcgcctgcaggactttaagctcgacttcggcaatttccaaggcaaaatg
agtgagaggtggcacggaggtatagctaccatttttcaaagtcctggcgatgaagtgtgg
ggagtagtatggaaaatgaacaaaagcaatttaagttctctggatgaacaagaaggagtt
aaaagtggagtgtatgttgtaatagagattaaagttacaactcaacaagggaaggacatc
acctgcaggagttacctgatgacgaattatgagagagcgcccccatcaccacagtataag
aaggttatctgcatgggtgcgaaagaaaacggtttaccgctggaatatcaagagaagtta
aacgtgatagaaccaaatgactataaaggaaagatctcagacgagatggaagacatcatc
aagaagggagaggcaaaactgttataa

DBGET integrated database retrieval system