KEGG   Rattus norvegicus (rat): 362376
Entry
362376            CDS       T01003                                 

Gene name
Herc6
Definition
(RefSeq) HECT and RLD domain containing E3 ubiquitin protein ligase family member 6
  KO
K22372  E3 ISG15--protein ligase [EC:2.3.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362376 (Herc6)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     362376 (Herc6)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   362376 (Herc6)
SSDB
Motif
Pfam: HECT RCC1 RCC1_2 PGA_cap
Other DBs
NCBI-GeneID: 362376
NCBI-ProteinID: XP_008761185
RGD: 1561739
Ensembl: ENSRNOG00000023969
UniProt: F1LPM8
Position
4q24
AA seq 1027 aa
MYFTWAPGRRQPRRLEAGTGLKLLKAASGERHSLLLFSNHRVYSCGDNSRGQLGQKSPQS
TKRPEPIQALSTVHIDLVSCGKEHSVAVCHQGRVFTWGAGSEGQLGIGESKEISFMPTKI
NSLAGIKIIQVSCGHYHSLALSEDGQVFSWGSNRQGQLGLGNNLCSQASPQKVKSLEGIP
LAQVAAGGTHSFALSLMGTSFGWGNNRSGQLALSGNSAKEQIYKPHSIGALKTLNVVYIS
CGYEHTSVLTEDGQVFTFGGSSSEQLQHSPRSGRGGPQLIEGIGGHVSQIECGSYHTIAY
VYTTGQVVSLGRGPSCTSNATHQEAACSDVTCLLSAKDLVDIEVKDIFAGAHANFVTTCR
HTRSTSVSMKILPEIIRITQPLVKKWRAAKKGKVHEDAKREISLIFSSPACLTASFLKKR
DAGENNFINVDLKLARDVFKMLTAEKWISSLITTCLEETLLRGLPYSSPHQEALLVFLLL
PECSIMQDPKNWKTLAFEFASAIHKMRSKSLTFLRNWWASLEVSSLNSLVQMLKKTIVSQ
LHNEVPMMKDTSNLKVSLEMMKEVQKILEKTNSHLHNEVPKMEDTSNLKVLLEVMKEVHE
ANCQLPENAFIMNDIFNFNTEEGIMAKQQMFFIKYYSMVFNDFPFILDLPSKIILMKHDS
SVKLSDEVKVAASPEKMGCPFFILKVRRSHLVEDTLRQLRQAEDFDLRKTLSVGFINEIR
PEGGGVSSEFFHCIFEEMTDPKYEMFMYPENGSNMWFPVNPKFEKSRYFLFGILCGLSLN
NLNVINLSFPLALYKKLLEQKPSLEDLKDLSLLLGRNLQEVLNCEAGVIEELHMYFSIYW
DQRDVDLIPDGISVPVNETNKRDYVSKCVDYIFNISIKTIYDEFHRGFYKVCNRDSIRHF
QPEELMAAIIGNPTCDWKQFENNSKYENGYSKSHPTILLFWKAFHELTLDEKKKFLLFLT
GCDRLHVKGLQNEGIRFRCPEVFSERDNPRSLTCHSILDLPKYSTMRRMKEALQVAINNN
KGFISPE
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgtacttcacctgggctccaggaaggcggcagcctcggcgcctggaggcaggaactggt
cttaagctcttgaaggcggccagcggggaacgccactcgctgctactgttcagcaaccac
agggtgtactcctgcggggacaacagcaggggccagctgggccagaagagtccgcagagc
accaaacggccagaaccaattcaggcactaagtactgtacacattgacctggtgagctgt
gggaaggagcactcagtggctgtctgccaccaaggaagggtcttcacatggggagccggt
tctgaagggcagctggggattggagaatctaaggaaataagcttcatgcctacgaaaata
aactctctggctggcataaaaataatccaagtttcctgtggacactaccactctttggca
ttatcagaagatggccaagtgttttcatggggaagtaacagacaaggacaactgggcctg
gggaataatttatgttcccaagccagcccacagaaggtgaagtccctggaggggatccca
ctggctcaagtagctgcaggtggcacacacagttttgctctgtctctcatggggacttca
tttggctgggggaacaacagatctgggcagctggccctcagtgggaacagtgctaaagag
caaatctacaagcctcattcaattggtgccctgaagactctcaatgtggtttatattagc
tgtggttatgagcacacttcagtgcttaccgaggatggacaagtgtttacatttggaggc
agtagctctgaacagctacagcacagccccaggagtgggagaggaggtccacaactcata
gaagggattggcggccatgtttcacagatagaatgtggaagttatcacaccattgcatat
gtctacaccactggtcaggtggtatctttaggccgtggaccaagttgcacaagcaacgca
actcatcaggaggctgcttgctctgacgttacctgcttgctatctgccaaggaccttgtg
gatattgaagtcaaagacatttttgctggagcacacgccaactttgtgacaacctgccgg
catactaggtccacaagtgtttccatgaaaatcctgccagaaattatccgaatcacccag
ccactggtaaagaaatggcgagcagcaaagaaaggaaaagtccatgaagacgccaaaaga
gaaatcagcttgatattttcatctcctgcttgtttgactgcaagttttttgaagaaaaga
gatgctggagagaataatttcattaacgtggacttaaaactggcaagggatgtcttcaag
atgttaacagcagagaaatggatttcctccttgataaccacttgtcttgaggagactctg
cttagaggtcttccatacagctctccacatcaagaagctctattagtttttcttttgctc
ccggaatgttccattatgcaggatcccaagaactggaagacactggcatttgaatttgca
agcgctattcataaaatgaggtcaaagtcattaacattcctgagaaactggtgggcatct
ttggaagtttcttctctgaactcactggtccagatgctaaagaaaaccatcgtctctcaa
ctgcataatgaagttccaatgatgaaggatacgtctaaccttaaagtttctttagaaatg
atgaaagaagtgcaaaagatactagagaaaaccaactctcatcttcataatgaagttcca
aagatggaggatacgtctaatcttaaagttctcttagaagtgatgaaagaagtgcatgag
gctaactgtcaacttccagaaaatgctttcatcatgaatgacatctttaacttcaataca
gaagaaggaataatggccaaacagcaaatgttctttataaaatactattctatggttttc
aatgattttccatttatccttgatttgccatccaaaattatattaatgaaacatgactca
tctgtaaagctgtcggatgaagtcaaagtcgctgcatctccagaaaagatgggatgcccg
ttctttatactgaaagtcagacgaagtcatctggtggaagacaccttgcgtcaattaaga
caagctgaagattttgaccttaggaagacactatcggtcggatttattaatgaaattcgt
cctgagggtgggggagtaagttctgagttcttccactgtatatttgaagagatgacagac
cccaaatatgaaatgttcatgtatcctgaaaatggttccaacatgtggtttccagtcaat
cccaagtttgagaagagcagatatttcctctttgggatcttatgtggactctccctaaat
aatttaaatgttatcaacctctctttcccactggctttatataaaaaacttttggagcaa
aagccatctttggaagatttaaaagaccttagtcttctcctggggaggaatttgcaagaa
gttctaaattgtgaggctggtgttattgaagaacttcacatgtatttttctatatactgg
gatcaaagagatgttgatttaattccagatgggatctctgtgcctgtgaatgaaacaaac
aagagagactatgtgtccaagtgtgttgattacatttttaacatttctataaagacaatt
tatgacgaatttcatagaggattttacaaggtgtgtaaccgggacagtattaggcatttc
cagcctgaagaactaatggcagcaataattggaaaccctacttgtgactggaaacaattt
gaaaataattcaaagtatgaaaatggatattccaaatcacacccaactattctactgttt
tggaaggctttccatgaactaactttggatgaaaagaaaaagttcctcttgtttcttaca
ggatgtgataggctacatgtaaaaggcctacagaatgaaggaataagattccggtgtcct
gaagttttcagtgaaagagataacccaagatcattgacatgtcacagtattctagacctg
cctaagtattccacaatgagaaggatgaaggaagcacttcaggttgcaatcaacaataac
aaggggtttatctcaccggaatga

DBGET integrated database retrieval system