KEGG   Rattus norvegicus (rat): 362378
Entry
362378            CDS       T01003                                 

Gene name
Fam13a, Fam13a1, RGD1309807
Definition
(RefSeq) family with sequence similarity 13, member A
Organism
rno  Rattus norvegicus (rat)
SSDB
Other DBs
NCBI-GeneID: 362378
NCBI-ProteinID: NP_001094332
RGD: 1309807
Ensembl: ENSRNOG00000007947
UniProt: D3ZA02
Position
4q24
AA seq 692 aa
MACEIMPLRSSQEDERPLSPFYLSAHVSQVSSVSTTGELLERTIRSAVEEHLFDVNSSAD
QSSEDSEPGPSSASSTPTRQRGHQFKKQDDVWYGQDKELINKENIPCGLSSCDECILNSQ
EAERFQDDICEYVGERSKAKRQKSSSRLAELCENHDGHLSTESLSSMQTQETAEPEAVEL
RSSESKEAERSWRDTQHCESPAMKIQEHPSISDTKQQRNQDDDDQQESFVPDLPQLDLTA
LCDKTWEEPIPSWQQENVESDEARLSPQAGRLIHQLLDEDSDPMLSPRFYAYGQSRQYLD
DTEVPPSPPNSHSFMRRRSSSLGSYDDEQEDLTPVQLTRRIQTLKKKIRKFEDRFEEERK
YRPSHSDKAANPEVLKWTNDLAKFRKQLKETKLKISEEDLTPRTRQRSNTLPKSFGSQLE
KEDEKKQELVDKAIRPSVEATLEGILRKLQEKRMESSRPEDIKDMTKDQIANEKVALQKA
LLYYESIHGRPVTKTERQIMKPLYDRYRLVKQILSRASTVPIIGSPSSKRRSPSLQPIIE
GETASFFKEIKEQEEGSEDDSSTKPDFTVTLKTDSSAHCFLDQLEDDADGFISPMDDKMP
SKCSQDSGLSNLHSASIPELLEYLQEIREEKKMIRKKLHDFEDNFFRQNGRNVQKEDRTP
MAEEYNEYKHIKAKLRLLEVLISKRDADSKSM
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggcttgtgaaatcatgccgctgcgaagctcacaggaagatgaaagacctttatcacct
ttctacctgagcgctcatgtatcccaagtcagcagtgtttcaacaactggagaactctta
gaaagaaccatcaggtcagcagtagaagagcacctttttgatgtcaacagttctgcagat
caaagttcagaggactcagaacctggaccatcatcagcatcttctacgcccacaaggcag
cgggggcatcaatttaagaagcaggatgatgtttggtatggtcaagacaaggagctcatc
aataaggagaatattccctgtggcctcagcagctgtgatgagtgtattttgaacagccag
gaagcagaaagattccaggatgatatttgtgagtacgttggggaaagaagcaaagccaag
cgtcagaaatccagctccaggcttgcagagctttgtgagaaccatgatggacacctgagc
acagaaagcctcagttccatgcagactcaagaaacagctgaacccgaagctgttgagctg
agatcttctgagagcaaagaagcagaaagaagctggagagacactcagcactgtgagagc
cccgcgatgaagattcaggagcatcccagtatatctgacaccaaacaacagaggaatcag
gatgatgacgatcagcaggagagctttgtcccagatctgccccagttggacctgacagca
ttgtgcgataagacctgggaagaacccatcccttcctggcagcaagagaatgtagaatct
gatgaagctcgcctctccccacaggctgggcgcctgattcaccagcttctggatgaggac
agtgaccccatgctgtcccccaggttctatgcctatgggcagagcaggcagtacctggat
gacacagaagtacctccttctccccccaattcccattctttcatgaggcggcgaagctcc
tcgcttggatcctacgatgatgagcaagaggacctgacgcccgtgcagctcaccagaagg
atccagacccttaaaaagaagattcggaagtttgaggataggtttgaagaagagaggaaa
tacagaccctcccacagtgacaaggcagccaaccctgaggttctgaagtggacaaatgac
ttggccaaattccggaaacagcttaaagaaacaaaattaaagatctctgaagaggacctc
acccccaggacacggcaacgaagcaatacactccccaagagtttcggttcccagctagaa
aaagaagatgagaagaagcaagaactggtggacaaagccatcaggcccagcgttgaagct
acactggaagggatactaaggaagctccaagagaagcgaatggaatccagccgtcctgag
gacattaaggatatgaccaaggaccagattgctaatgagaaagtggctctgcaaaaagcc
ctgctctactacgaaagtatccacgggcggccggtgacaaagactgagcgtcagattatg
aagccactatatgatcggtaccgactggtcaaacagatactgtcccgggccagcactgtc
cccatcattggttccccttccagcaaacggagaagcccttcgctgcagccaattattgag
ggtgaaactgcttccttcttcaaggagataaaggaacaagaggagggatcagaagatgac
agctccacaaagcccgacttcactgtcactctgaaaacagacagcagtgcacattgcttt
ctggaccaacttgaagatgacgccgatggatttatttcaccaatggatgacaaaatgcca
tcgaaatgcagccaggactcaggcctttcaaacctccactctgcttcaatacctgaactc
ttggaataccttcaggaaataagagaagaaaagaaaatgattcgaaagaaacttcatgat
tttgaagacaattttttcagacaaaatgggagaaatgtccagaaggaagaccgtactcca
atggctgaagaatacaatgaatataagcacataaaggcgaagctacgtttgctggaggtg
ctcatcagcaaaagagacgctgattccaaatccatgtga

DBGET integrated database retrieval system