KEGG   Rattus norvegicus (rat): 362391Help
Entry
362391            CDS       T01003                                 

Gene name
Mxd1, Mad-1
Definition
(RefSeq) max dimerization protein 1
  KO
K09114  MAX dimerization protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362391 (Mxd1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    362391 (Mxd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH APG6_N SlyX ZapB BPL_N
Motif
Other DBs
NCBI-GeneID: 362391
NCBI-ProteinID: NP_001094219
RGD: 1564525
Ensembl: ENSRNOG00000017720
UniProt: F1LRY0
Position
4q34
AA seq 232 aa AA seqDB search
MATAVGMNIQLLLEAADYLERREREAEHGYASMLPYSSKDRDAFKRRNKPKKNSTSSRST
HNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQID
QLQREQRHLKRRLEKLGAERTRMDSVGSVVSSERSDSDREELDVDVDVDVDVDVDVDVES
TDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSASVKRAKLQDGHKAGPGL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagccgtcgggatgaacatccagctgctgctggaggcggccgactacctggag
cggcgggagagagaagctgaacatgggtatgcctccatgttgccatacagtagcaaggac
agagatgccttcaaacggagaaacaagcccaagaagaacagcaccagtagcagatcaact
cacaatgagatggagaagaacaggcgtgctcacctccgcctgtgcctagagaagctgaag
gggctggtaccgctgggccccgagtcaagccgacacaccaccctgagtttgctgacaaaa
gccaaattgcacataaagaaacttgaagattgtgacaggaaagctgtccaccaaatagac
cagcttcagcgggagcagcggcacctgaagcggcggctggagaagctgggtgctgagagg
actcggatggacagcgtgggctctgtggtgtcttcagagcgctccgactctgacagggaa
gagctggacgtggacgtggacgtggacgtggatgtggatgtggatgtggacgtggagagc
acagactacctcaatggggacctgggctggagcagcagcgtgagtgactcggacgagcgg
ggcagcatgcagagcctgggcagtgatgagggctactccagtgccagtgtcaaaagagcc
aagctccaggacggccacaaggcaggtcccgggctatag

DBGET integrated database retrieval system