KEGG   Rattus norvegicus (rat): 362409
Entry
362409            CDS       T01003                                 

Gene name
Sumf1
Definition
(RefSeq) sulfatase-modifying factor 1 precursor
  KO
K13444  formylglycine-generating enzyme [EC:1.8.3.7]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    362409 (Sumf1)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.3  With oxygen as acceptor
    1.8.3.7  formylglycine-generating enzyme
     362409 (Sumf1)
SSDB
Motif
Pfam: FGE-sulfatase
Other DBs
NCBI-GeneID: 362409
NCBI-ProteinID: NP_001102109
RGD: 1309939
Ensembl: ENSRNOG00000006813
UniProt: D4A7I8
Position
4
AA seq 372 aa
MAAPAGEPAPRCCTGLAQVFLLLVLACGAAGSDEAEAGEGAVSLAGSCGCGTPQRAGAHG
SSAAAQRYSREANAQGLTSGPRSLALTKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTVD
AFYMDAYEVSNADFEKFVNSTGYLTEAEKFGDSFVFEGMLSEPVKAQIHQAVAAAPWWLP
VKGADWRHPEGPDSTILHRSNHPVLHVSWNDAVAYCAWAGKRLPTEAEWEYSCRGGLQNR
LFPWGNKLQPKGQHYANIWQGEFPVTNTGEDGFQGTAPVDAFPPNGYGLYNIVGNAWEWT
SDWWTVHHSAEETLNPKGPTSGKDRVKKGGSYMCHKSYCYRYRCAARSQNTPDSSASNLG
FRCAADHLPTAN
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgcgcccgcgggagagcctgctccccgctgctgtacagggctggctcaggtcttc
ttgctgctggtgctggcgtgcggggcagcggggagcgatgaggccgaggccggggaaggt
gcggtgtccctcgctggttcctgcggctgcggaacgccccagagggctggggcccatggc
agctcggcggccgcgcagcgctactcccgggaggcgaatgcccagggcctgacctcgggc
ccacgatcgctcgctctcactaagatggtccccatccctgctggagtatttacaatgggc
actgatgatcctcagatcaagcaggatggagaagcccctgccaggagagtcactgtcgat
gccttttacatggatgcctatgaagtcagcaacgctgattttgagaagttcgtgaactca
actggctatttaacagaggctgagaagtttggagactcttttgtctttgaaggcatgctg
agtgagccagtcaaggcgcaaattcaccaggcagttgcagctgctccatggtggttacct
gtcaagggcgctgattggagacacccagagggcccagactccactattctgcacaggtca
aatcatccagtcctccatgtctcctggaatgacgccgttgcctactgcgcatgggcgggg
aagaggctgcccacggaggcagagtgggagtacagctgcagaggaggcctgcagaacagg
cttttcccctggggcaacaaactgcagcccaaaggacagcattatgccaacatttggcag
ggcgagtttcctgtgaccaacactggcgaggatggcttccaaggaactgcccccgttgat
gcctttcctcccaatggctatggcttatacaacatagtggggaacgcatgggagtggacc
tcagactggtggaccgttcaccattctgctgaggaaacgctcaacccaaaaggccccact
tctgggaaagaccgagtgaagaagggtggatcctacatgtgccataagtcctattgctac
aggtatcgctgtgcagctcgaagccagaacacaccagatagctctgcatccaacctggga
ttccgttgtgcagcagatcacctgcccactgcaaactga

DBGET integrated database retrieval system