KEGG   Rattus norvegicus (rat): 362418Help
Entry
362418            CDS       T01003                                 

Gene name
Irak2
Definition
(RefSeq) interleukin-1 receptor-associated kinase 2
  KO
K04731  interleukin-1 receptor-associated kinase 2 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
rno05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    362418 (Irak2)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    362418 (Irak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    362418 (Irak2)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     362418 (Irak2)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: TKL group
  IRAK family
   362418 (Irak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death
Motif
Other DBs
NCBI-GeneID: 362418
NCBI-ProteinID: NP_001020593
RGD: 1309584
Ensembl: ENSRNOG00000021817
UniProt: Q4QQS0
Position
4q42
AA seq 624 aa AA seqDB search
MACYIYQLPSWVLDDLCRNIDTLSEWDWMQFASYVITDLTQLRKIKSMERVQGVSITREL
LWWWSMRQATVQQLVDLLCHLELYRAAQIVLSWKPAPDSLSPLSAFPEAVKPGPVATSGR
NLKDDQKKGQPVKPCSFLSSGTTMAGAQQQASCQRPCEEDAPCSLKTDVPDSLQSKYCST
SIPKQEKLLNLPGDRLFWSEADIVQATEDFDQSHRISEGTFADIYRGQRNGVAFAFKRLR
EVTGSSPGSMDRFLQAEMQLCLRCCHPNILPLLGFCTGRQFHSLIYPYMANGSLQDRLWA
QGDSDMLSWPQRASICSGLLLAVEHLHSLDIIHSNVKSANVLLDQHLNPKLAHPVAHPCP
TNKKTKYTVMKTHLFQASAAYLPENFIRVGQLTKQVDIFSCGIVLAEVLTGIPAMDKDRS
PVYLKDLLLSEIPSNTSSVHSRKTSMGKVVVKEICQKHLERKAGLLPEACAETWATAVSV
CLRRREASLEEARVSMAGVEEQLRGQLSLPWSRVSEDTGSSSNTPEETDDVDNSSLSVPS
SVMVVSCARVSSPPPSMGNGTAQPSTSGRQEADSSSEACAGPQPPQEATETSWKIEINEA
KRRLMENILLYKEEKLDSVELFGP
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggcttgctacatctaccagctgccgtcctgggtactggacgacctgtgccgcaatatc
gacacgctcagtgagtgggactggatgcagttcgcttcctatgtgatcacagacctgaca
cagctgaggaagatcaagtccatggagagggttcagggggtgagcatcacccgggagctg
ctgtggtggtggtccatgcggcaggccactgtccagcagctggtggacctcctgtgtcac
ctggaactctaccgagctgcccagattgtcctgagctggaagccggctcctgacagcttg
tctcccctctcggccttcccagaggctgtgaagccaggtcctgtggctacttctggaaga
aacctcaaggatgaccagaagaagggccagcctgtgaaaccatgctcctttctgagctca
gggaccaccatggctggcgcccagcagcaggcctcatgccaacgtccatgcgaggaggat
gccccttgttccctgaaaactgatgtacctgactctctccaatctaagtattgtagcacg
tccatccccaagcaggaaaagcttttgaatttgcccggagacaggcttttctggagtgaa
gcagatatcgttcaagcaactgaggactttgaccaaagccaccgaatcagtgaggggacc
tttgccgatatctaccggggacaaaggaatggcgtggcctttgccttcaagaggctcagg
gaggtgactggctcaagtccagggtccatggacagattcctgcaggcggagatgcagctc
tgcctcagatgctgccaccccaacatcctacctctgctgggcttctgcactggaagacag
ttccacagcctcatctacccctacatggccaatggctctctgcaggacagactctgggct
cagggcgactcagacatgttgtcctggccacagcgtgccagcatctgctcagggcttctt
ctagctgtggaacacctgcatagcctggatatcatccacagtaatgtgaagagtgccaac
gttttgctggaccagcatcttaaccccaagctagcccatccagtagctcacccgtgtccc
accaataaaaagaccaaatatactgtaatgaagactcacctgttccaggcctcagctgcg
tatctgcctgaaaacttcatccgagtgggacagctcaccaagcaagtagacatcttcagc
tgtggaattgtattggccgaggttctcaccggcatccctgcaatggacaaggaccgcagt
ccagtttacctgaaggatttgcttctcagtgagattcccagcaatacttcctcagtccac
tccaggaagaccagcatggggaaggtggtggtgaaagagatctgccagaagcacttggag
aggaaggcagggctactgcctgaggcctgcgcggaaacctgggccaccgctgtgagcgtc
tgcctgcggagacgggaggccagcctggaggaggcacgagtctccatggctggggtagag
gagcagctcagagggcagctgtccctcccctggagcagggtttctgaggatacgggctca
tcttctaataccccagaggaaacggatgacgttgacaattccagcctcagtgtcccctct
tctgttatggtggtgtcatgtgcaagggtttcctcccctccaccatccatgggaaatggg
acagcacagccatctaccagtgggaggcaggaggctgactcctcctccgaggcttgtgca
ggcccacagccacctcaggaagctacagagacttcatggaaaattgagatcaatgaggcc
aaaaggagactgatggagaacatcctactgtataaagaagagaaactggacagcgttgag
ctttttggaccctga

DBGET integrated database retrieval system