KEGG   Rattus norvegicus (rat): 362423Help
Entry
362423            CDS       T01003                                 

Gene name
Rassf4
Definition
(RefSeq) Ras association domain family member 4
  KO
K09851  Ras association domain-containing protein 2/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04392  Hippo signaling pathway - multiple species
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04392 Hippo signaling pathway - multiple species
    362423 (Rassf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Motif
Other DBs
NCBI-GeneID: 362423
NCBI-ProteinID: NP_001019446
RGD: 1307785
Ensembl: ENSRNOG00000013526
UniProt: Q566C5
Position
4q42
AA seq 322 aa AA seqDB search
MKEDCSPSSHVPISDSKFILKSELLSLLKTYNCYHEGRSFQLRHREEEGTLIIEGLLNIA
WGLRRPIRLQMQDDRERVHLPSATWVPERLSYLQKDASPQDSKVPAEEPSTQPANKGEVS
RDGSGPLQEEEEEVPQLMRTKSDASCIIQRRCKSRAPGEAQKIRRHRFSINGHFYNHKTS
VFTPAYGSVTNVRVNSTMTTQQVLTLLLNKFRVEDGPSEFALYTVHESGEQTKLKDCEYP
LISRILHGPCEKIVKIFLMEADLSEEVPHDVAQYIKFEMPVLDSFVEKLKEEEEREIIKL
TMKFQALRLTMQQRLEQLVEAK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagattgctcgcccagttctcatgtgcccatcagcgacagcaagttcattcta
aagtcagagctcttaagcctgcttaaaacctacaactgctaccacgagggcaggagcttc
cagctaagacaccgagaggaagaagggactctgatcatcgaaggactcctcaacatcgcc
tggggacttagacggcccatccggctccagatgcaggatgatcgggaacgagtgcacctg
ccttctgccacatgggtgcctgagcggctcagttacctccaaaaggacgcttcaccccag
gacagcaaggtccctgctgaggagcctagcactcaacctgcaaataagggagaggtttcc
agagatggctcaggacccctgcaggaagaagaggaggaggtcccgcagcttatgcggaca
aagagtgatgccagctgtataatccagaggaggtgcaaatcccgggcaccgggcgaggcc
cagaagattcgacggcaccggttctccatcaatgggcacttttataaccacaagacctcg
gtgttcacgcctgcctatgggtctgtgaccaacgtccgggttaacagcactatgaccacc
cagcaggtactcaccctgctgctaaacaagttccgggtagaagatggccccagtgagttc
gcactctacaccgtccatgagtctggggagcagacaaaattgaaagattgtgagtaccca
ctgatatccagaatcctgcatgggccctgtgagaaaattgtcaagatcttcttgatggaa
gctgacttgagtgaggaagtgccccatgatgttgcccagtacattaagttcgaaatgcca
gttctggacagctttgttgaaaaattaaaagaagaggaggagagagaaataatcaaactg
accatgaagttccaagctttgcgcctgacaatgcagcagcgtctggaacagctggtggag
gccaagtaa

DBGET integrated database retrieval system