KEGG   Rattus norvegicus (rat): 362424Help
Entry
362424            CDS       T01003                                 

Gene name
Tmem72, RGD1308850
Definition
(RefSeq) transmembrane protein 72
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM72
Motif
Other DBs
NCBI-GeneID: 362424
NCBI-ProteinID: NP_001102113
RGD: 1308850
Ensembl: ENSRNOG00000023340
UniProt: D4A2U6
Position
4q42
AA seq 275 aa AA seqDB search
MKLQVFWTGLEYTCRLLGITTAAVLIGVGTETFLRGRFKSLAFYLLFTGVTISVCEGTYF
VAQLLAICFKCQPGSLAHRAKEKAHWLGCFQKFLAYMLLSVACFLHPVLVWHVTIPGSML
IITGLAYFLLSKRKKKKAAPEVMPPTEQYRDPSSSIVSTTGSGDTEQTYTFHEAFKEGPS
SFLIHMKSILKGTKKPRVLQAQDTLMELALEPADSLAKKKQVHFEDNVVRIIPSLTEGLG
DSDSGPEETSSDTTPIIPPSQTPLFLPSLMATDLF
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaagctccaagtattctggactggactggagtatacctgccggctattgggcatcacc
acggctgcagtactgattggagtgggcactgagaccttcctccgggggcggttcaaaagc
ctggccttctatctgctgtttacaggagtcaccatctctgtgtgtgaagggacctacttt
gtggctcaactgttggccatctgcttcaagtgtcagccggggtctctggcacacagagca
aaggagaaggcccactggctgggctgcttccagaagttcctcgcctacatgctgctgtca
gtggcctgtttcctccaccctgttctggtctggcatgtgaccataccaggctccatgcta
atcatcactggcctggcctacttcctgctgagcaaacggaagaaaaaaaaggctgcccca
gaggtgatgccccccacggagcagtacagggacccttccagcagcattgtgagtaccaca
ggctctggggacactgagcaaacctatactttccatgaggccttcaaggaggggcccagc
tcattcctcatccacatgaagagcatcctgaaggggaccaagaagccacgtgtcctgcag
gcccaagataccctaatggaactggctctagagccagctgactccttggccaagaaaaag
caggtacactttgaagacaatgtggtcagaatcatcccatcgctcactgaaggtctaggt
gatagtgacagtgggccagaggaaaccagttctgacacaacccccatcatccctccctcc
cagaccccactctttctgccttctctcatggccactgacctgttctga

DBGET integrated database retrieval system