KEGG   Rattus norvegicus (rat): 362431
Entry
362431            CDS       T01003                                 

Gene name
Clec4a3, Dcir3
Definition
(RefSeq) C-type lectin domain family 4, member A3
  KO
K10057  C-type lectin domain family 4 member A
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:rno04054]
    362431 (Clec4a3)
   04090 CD molecules [BR:rno04090]
    362431 (Clec4a3)
   04091 Lectins [BR:rno04091]
    362431 (Clec4a3)
Pattern recognition receptors [BR:rno04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   362431 (Clec4a3)
CD molecules [BR:rno04090]
 Proteins
  362431 (Clec4a3)
Lectins [BR:rno04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Asialoglycoprotein receptor (ASGR) subgroup
    362431 (Clec4a3)
SSDB
Motif
Pfam: Lectin_C DUF2418 UL45
Other DBs
NCBI-GeneID: 362431
NCBI-ProteinID: NP_001005891
RGD: 1359528
Ensembl: ENSRNOG00000010018
UniProt: Q5YIS0
Position
4q42
AA seq 237 aa
MFSENIYINTNFKNKYDSSDIDTDFRPDPPKKSKSQKSCHKFSKVLFTSLIIYFLLLTIL
FSSALIILFKKYSQLLEEKTIMKELNYTELECTKWDSLLEDKVWSCCPKDWKPFDSNCYF
PSTDSVESWMESEEKCSGIGAHLVVIHSQEEQDFLPRILDTHAAYFIGLSDPGHRQWQWV
DQTPYNGNATFWHEGEPSSDNEQCVIINHHENTGWGWSDSSCSDKQKLVCQVKKIYL
NT seq 714 nt   +upstreamnt  +downstreamnt
atgttttcagaaaacatttatattaacacgaacttcaaaaataaatatgactcctcagac
atcgacacagactttcggccagatcccccaaagaagagcaagtctcagaaaagttgccac
aagttctccaaggtcctctttacctcactcataatctatttcctgctgttgacaatctta
ttctccagtgctctgatcattctgtttaaaaaatattctcagcttctggaagaaaaaaca
attatgaaggaactgaactatactgaattggagtgtacaaaatgggattcactcttggaa
gacaaagtctggagctgttgcccaaaggattggaagccatttgattccaactgctacttc
ccttccactgactcagtagaatcttggatggagagtgaggagaagtgctccggcataggt
gctcatctggtggtgatccacagccaggaagagcaggatttcctgcccaggatcctggat
actcatgctgcttattttataggactttcagatccaggtcatcgacaatggcaatgggtc
gatcagacaccatacaatgggaatgccacattctggcatgaaggtgagcccagcagtgac
aatgaacaatgtgttataataaatcatcatgagaatactggatggggctggagtgatagc
tcttgcagtgataaacagaagttggtttgtcaggtgaaaaaaatatacttatga

DBGET integrated database retrieval system