KEGG   Rattus norvegicus (rat): 362452Help
Entry
362452            CDS       T01003                                 

Gene name
Borcs5, Loh12cr1
Definition
(RefSeq) BLOC-1 related complex subunit 5
  KO
K20819  BLOC-1 related complex subunit 5
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362452 (Borcs5)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   BLOC-one-related complex (BORC)
    362452 (Borcs5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LOH1CR12 DUF1664
Motif
Other DBs
NCBI-GeneID: 362452
NCBI-ProteinID: NP_001102120
RGD: 1307624
Ensembl: ENSRNOG00000006505
UniProt: B1H257
Position
4q43
AA seq 195 aa AA seqDB search
MGSEQSAEAESRPGDLNASVTPSPAKHRAKMDDIVVVAQGSQASRNVSNDPDVIKLQEIP
TFQPLLKGLLSGQTSPTNARLEKLDSQQVLQLCLRYQDHLHQCAEAVAFDQNALVKRIKE
MDLSVETLFCFMQERQKRYAKYAEQIQKVNEMSAILRRIQMGIDQTVPLMERLNSMLPEA
ERLEPFSMRPERERH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgagcagagcgcggaggccgagagccgccccggcgatctgaacgcctcagtg
actccatctccggctaaacatcgggccaagatggatgatatcgtggtggtagctcagggc
tctcaggcctcaaggaatgtcagcaatgatcccgatgtcatcaagctgcaagagattcca
accttccagccccttttaaaagggctcttgagtggacagacgtccccaacaaacgcaagg
ctggagaagctggactctcagcaggtgctgcagctctgcctccggtaccaagaccacctg
caccagtgcgcagaggccgtcgctttcgaccagaatgctctggtcaagcgaatcaaagag
atggatctgtccgtggaaaccctcttttgcttcatgcaggagcgccagaaaagatacgcc
aaatacgctgaacagatccagaaggtgaacgagatgtcggccatcctgcgccgtatccag
atgggcatagaccagacggtgccactcatggagaggctcaacagcatgctgccagaggcc
gagcgcctggagcccttcagcatgaggcctgagcgggagcgccactag

DBGET integrated database retrieval system