KEGG   Rattus norvegicus (rat): 362456Help
Entry
362456            CDS       T01003                                 

Gene name
Arhgdib
Definition
(RefSeq) Rho GDP dissociation inhibitor beta
  KO
K12462  Rho GDP-dissociation inhibitor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04722  Neurotrophin signaling pathway
rno04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    362456 (Arhgdib)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    362456 (Arhgdib)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    362456 (Arhgdib)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   362456 (Arhgdib)
  Exosomal proteins of other body fluids (saliva and urine)
   362456 (Arhgdib)
  Exosomal proteins of colorectal cancer cells
   362456 (Arhgdib)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rho_GDI
Motif
Other DBs
NCBI-GeneID: 362456
NCBI-ProteinID: NP_001009600
RGD: 1305383
Ensembl: ENSRNOG00000005809
UniProt: Q5M860
Position
4q43
AA seq 200 aa AA seqDB search
MTEKDEQPQLEEGEDELDSKLNYKPPPQKSLKELQEMDKDDESLTKYKKTLLGDVPVVAD
PTVPNVTVTRLSLVCDSAPGPITMDLTGDLKALKKDTFVLKEGIEYRVKINFKVNKDIVS
GLKYVQQTYRNGMKVDKATFMVGSYGPRPEEYEFLTPVEEAPKGMLARGTYHNKSFFTDD
DKQDHLTWEWNLAIKKDWTD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacggagaaggatgagcagccacagctggaggagggagaggatgagctggacagcaag
ctcaactacaagccgccccctcagaagtccctgaaggagctgcaggagatggacaaagat
gacgagagtctaaccaagtacaagaaaacactgctgggagatgtccccgtggtagcagac
ccaacagttcccaacgtgactgtgacccggcttagccttgtttgtgacagtgcaccagga
ccaatcaccatggaccttactggtgatctcaaggcgctcaaaaaggatacatttgtgcta
aaggaaggtatcgaatacagggtcaagattaacttcaaagtgaataaggatattgtgtct
ggcctgaagtatgttcagcagacgtaccggaatgggatgaaagtggataaagctacgttc
atggttggcagctacgggcctcgaccagaggagtacgagttcctcactccagtagaggag
gctcccaagggcatgttggcccgaggcacttaccacaacaagtccttcttcaccgatgat
gacaagcaggaccacctcacctgggaatggaacctggccattaagaaggattggacagac
tga

DBGET integrated database retrieval system