KEGG   Rattus norvegicus (rat): 362472
Entry
362472            CDS       T01003                                 

Gene name
Cspp1, RGD1307055
Definition
(RefSeq) centrosome and spindle pole associated protein 1
  KO
K16771  centrosome and spindle pole-associated protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362472 (Cspp1)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    362472 (Cspp1)
   Spindle formation proteins
    362472 (Cspp1)
SSDB
Motif
Pfam: CCDC66
Other DBs
NCBI-GeneID: 362472
NCBI-ProteinID: NP_001178793
RGD: 1307055
Ensembl: ENSRNOG00000021718
UniProt: F1LPI1
Position
5q11
AA seq 1203 aa
MADGLDEFIEEQKVKLAQDKAELESDLPYMEMKGKASEKLSENSKILISMAKENIPPNSQ
QPKGSLGIDYGLSLPLGEDYEQKKHKLKEELRQDYRRYLTQKNFLSTGETDPSTLGVSLP
IGDRLSAKERLKLERNREYNQFLRGKEESTEKVRQVERNIEAKSQRNKNPVSQGKSDLPS
QALTSYAHSEGPAHEELLNQRQREEGRYRQLDDGIELRTRRPLKQTNEEIGISGTSHQSF
SSKTAAPERRACRFNEERVLDKQYCRADRDPDISEDMDDRFRFESDFDRKFLRVYTNDRP
HGSRQCADEEGISEEPKTQISCAENKSVRDNGPPKCADVNVTSPFAGMLFGGEDREVAKK
KKEKYRQELLEQIAEQQQKKRREKDLAFGITTSGVQDPEKSPDRLKQFSLTPGHFEETIP
PERPRVAFQTPPPPFSAPSVPPVPPVHSAPSHNEDLPSGLGSTLGEVVHPRIVPVPLNPL
PPPLLPHLVPNYRTPYDDAYYFYGARNTLDPNIVYYGSGMIGGHPVPHVSAPVTHQVAPP
AVSTVGQNEQTVLSDRLRNSGLVFEDKPKPSTQSLKSYQEALQEQIREREARKKKERLEK
EEYEAKLEAEMRIYNPWGKGGGGAPLRDAKGNLITDLNRMHRQNIDAYHNPDARAYEDKR
AVVSIDQNLATSNAENLEDSASKNSGPLQTQGSPFARGNTFGEPLSELQIKQQELYKNFL
RFQIEEKRQREEAEREKLRVAEEKEEKRLAEQRARIQQEYEEEQERRREKEEEQRLKNEE
LIRLAEERRKEAERKKKEEEEKHNLQLQHYYERENVIGDEAKYLRQPSPVVPALQNKTAS
KIQRPPSVDTIISSFIHESSMSRAQSPPVPARKNQLRAEEEKKNVIMELSEMRKQLRSEE
RRLQGRLLHLESDDDDIPIRKRERNPMDIFDMARHRVQAPVRRPSPKGLDATTFQNIHDF
NELRERDSDTRVDLRLMYPDPPRDHHTLEIQQQALLREQQKRLNRMKMRRDAGADLDAIP
TGNEQGRRVPRDDTNDFLKNSLLESDSAFIGAYGETYPITEEDAFPPPSQLPSARERRRN
KLKGLEFESSRLHTPQDGLSLNSTSSVNVDQVRMRNEERLRRLTEHQKKPTHTDDEGSLV
DPDDIMRHLGDDGRNSVATEPWLRPGTSETLKRFMAEQLNEGQQQVPGKPGTFPWQGLSA
AHA
NT seq 3612 nt   +upstreamnt  +downstreamnt
atggcagatggcttggatgaatttattgaagagcaaaaagtgaaactggcccaagacaaa
gcagagttggaaagtgacctgccgtacatggagatgaagggaaaggcatcagagaaactc
tctgaaaacagtaaaatcttaatctctatggctaaggagaacataccaccaaacagccaa
cagcccaagggatccttaggtattgattatgggttaagtttaccacttggagaagattat
gaacagaagaaacataaattaaaagaagaattgagacaagattatagacgctatcttact
cagaagaatttcctatctactggtgaaacagacccatctactctgggagtttctcttcct
attggtgatcggttatctgccaaggaaaggttgaaacttgaacgcaaccgagaatacaat
caatttctcaggggtaaggaagaatccacagaaaaagtcagacaggtagaaaggaatatt
gaggctaagagtcaaaggaataaaaaccctgttagtcaaggtaaatctgatctgccttca
caagcactgacttcatacgcacattcagagggacctgcacatgaagagcttctaaaccaa
agacagcgggaggagggccgataccgacagctagatgatggaattgaattaaggactaga
agaccgcttaaacaaacaaatgaagaaataggcatttctggtacaagccaccaaagcttt
tccagcaagacagctgctccagagagaagagcttgcaggtttaacgaggagcgtgtgctt
gacaaacagtactgtagagctgaccgtgatcctgacataagtgaagacatggacgacagg
tttagatttgaaagtgattttgatcgaaaatttttgagagtatatacaaatgacaggcca
catgggagcagacaatgtgcggatgaggaaggcatctcagaagagccaaaaacgcagatc
tcctgtgctgaaaataaaagtgttcgagataatggaccacccaaatgtgctgatgtcaat
gtcaccagtcccttcgcaggcatgctctttggaggtgaagatcgagaagtagccaagaag
aagaaagagaagtatagacaagaactactagagcagatagctgagcagcagcagaagaag
agacgagaaaaagatttagcattcggaattacaacttctggagtccaggaccctgaaaaa
tcgcctgatagactaaagcagtttagtttgacaccaggacactttgaagagacgatacca
cccgagagacccagagtagctttccagacacctcccccccccttctctgccccgtctgtc
ccacctgtcccaccagttcattccgccccttctcacaatgaagacttgcccagtggactc
ggcagcacccttggtgaagtggtgcatcccagaattgtacctgtgcctctgaatccgctt
ccacctccgctccttccccacctcgttcctaactatcgaactccttatgacgacgcatac
tatttttacggtgccaggaatacactggatcccaatattgtgtactatggttcaggaatg
attggaggacatcctgtccctcatgtctctgcccctgtcactcaccaagtagcaccacca
gctgtgagtactgttggacagaacgagcagacagttcttagtgatcgactcaggaattca
ggactggtctttgaggataagccaaaaccttccacacagtcacttaaatcttaccaagaa
gctttgcaggagcagattcgggaaagagaagcaagaaagaagaaagaacgtttagaaaaa
gaagaatatgaagctaaactagaagctgaaatgaggatttacaacccctgggggaagggc
ggaggaggtgcccctctccgagacgccaaaggaaatctgataactgacttgaataggatg
cacagacagaatatagacgcctaccataacccagacgcaagagcgtatgaagataaaagg
gctgttgtgtctatagaccaaaatttagccacttcaaatgctgagaacctagaagattct
gcaagtaaaaactcaggtcctttacaaacacaaggctctccttttgcccggggaaataca
ttcggcgagccactcagcgagcttcaaattaaacagcaagaattatacaagaattttctt
cgttttcagattgaggagaagagacaaagagaagaagcggagcgggagaagctgagagtt
gctgaagagaaggaagaaaagcggcttgcagagcagagggcaagaattcagcaagagtac
gaggaggagcaggagcggaggagggagaaggaagaggagcaaaggctgaaaaatgaagaa
cttattcggttagctgaagagaggcgaaaagaagcagaaagaaagaagaaggaagaggag
gaaaagcataacttgcagcttcagcattactacgagagagagaatgttatcggagatgaa
gcaaagtacttgagacagccttctcctgtagttcctgctcttcagaacaaaactgcaagc
aaaatccaaagacctccttcagtcgacaccatcataagttccttcattcatgaaagctcc
atgtcccgggcacagtctcctccggtccctgcgaggaagaaccaactccgtgcagaagag
gagaaaaaaaatgtaattatggagttatcagaaatgaggaagcagctccgaagtgaggag
aggcgtttgcagggtcggctgctgcacctggaaagcgacgacgacgacatccctatcagg
aaaagagagaggaaccccatggatatatttgatatggctagacatcgggtacaggctcct
gtcagaagaccatcgcctaagggcctagatgctactacgtttcagaatattcacgacttt
aacgagctgagagagagggattcagatactcgggtggatctgagattaatgtacccagat
cctccacgagatcatcacacgttggagattcagcagcaggccctactccgagagcagcag
aagaggctcaacagaatgaagatgcggcgagatgcgggagctgatttagacgccatcccc
actggtaatgagcaaggacgcagagtgcccagagatgacactaatgattttttgaaaaat
tcattattagaatctgatagtgcttttattggtgcttacggtgagacgtatcctatcact
gaagaggacgccttccctccaccgtcacagttgccctctgcaagggaacgcaggaggaac
aagttaaaaggactagagtttgagagtagtcggctccacacaccgcaagatggtctctct
ttaaactctacctccagtgtaaatgtcgatcaggttagaatgagaaatgaggagagactg
agaagactgactgagcatcagaagaaacccactcacacagatgatgagggttcactggtt
gatcctgacgacatcatgagacacttgggtgatgatggacgcaactctgtggcaactgag
ccctggctccgccctggcacttccgaaactctgaaacggttcatggcagagcagctgaat
gagggacagcagcaggttcctgggaaaccaggcacttttccttggcagggactatctgct
gcacatgcttaa

DBGET integrated database retrieval system