KEGG   Rattus norvegicus (rat): 362481
Entry
362481            CDS       T01003                                 

Gene name
Tox
Definition
(RefSeq) thymocyte selection-associated high mobility group box
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: HMG_box HMG_box_2 YABBY
Other DBs
NCBI-GeneID: 362481
NCBI-ProteinID: NP_001102124
RGD: 1310455
Ensembl: ENSRNOG00000010777
UniProt: D4A1U5
Position
5q12
AA seq 525 aa
MDVRFYPPPAQPAAAPAAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPVSQSYPG
PSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQNMDLPEITV
SNMLGQDGTLLSNSISVMQEIGNAEGAQYSSHPQLAAMRPRGQPTDLRQQASMMQHGQLT
TINQSQLSAQLGLNMGGTNVPHNSPSPPGSKSATPSPSSSVHEDECEDTSKINGGEKRPA
SDMGKKPKTPKKKKKKDPNEPQKPVSAYALFFRDTQAAIKGQNPNATFGEVSKIVASMWD
GLGEEQKQVYKKKTEAAKKEYLKQLAAYRASLVSKSYNDPVDVKTSQPPQLVNSKPSVFH
GPSQAHSALYLSSHYHQQPGMTPQLTAMHPSLPRNIAPKPNNQMPVTVSIANMAVSPPPP
LQISPPLHQHLSMQQHQPLVQQPLASQLPMQVQTALHSPTMQQGFTLQPDYQTIINPTST
AAQVVTQAMEYVRSGCRNPPPQPVDWSTDYCSSGGMQRDKALYLT
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggacgtaagattttatccacctccagcccagcccgctgctgcgcccgccgctccctgt
ctgggaccttctccctgcctggacccctactattgcaacaagtttgacggtgagaacatg
tatatgagcatgacagagccgagccaggactatgtgccagtcagccagtcctaccctggc
ccaagtctggaaagtgaagactttaacatcccacccattactcctccctcactccctgac
cactctctggtgcacctgaatgaggtggagtccggttaccactctctgtgtcaccccatg
aaccacaatggcctgcttccattccatccacaaaacatggacctgccagagatcaccgtg
tccaacatgctgggccaggatggcacactgctctccaattccatctctgtgatgcaagag
attggaaatgctgaaggagctcagtacagttcccatcctcagctggcagccatgaggccg
agaggccagcctacagacctcagacagcaggcaagcatgatgcagcacggccagctgacc
accatcaaccagtcacagctgagcgcacagttgggcttgaacatgggaggaaccaacgtc
ccacacaactccccttctccacctgggagcaagtctgcaaccccttcgccttccagctcg
gtgcatgaggatgagtgtgaggatacctccaagatcaatggaggagagaagcggcctgcc
tctgatatgggaaaaaaaccaaaaactcctaaaaagaagaagaagaaggatcctaatgag
ccccagaagcctgtgtctgcctatgctttgttctttcgtgatacccaggctgccatcaag
ggccaaaatccaaatgctacttttggtgaagtctctaagattgtggcatccatgtgggat
ggcctaggagaagagcagaaacaggtctacaagaagaaaactgaggctgcaaaaaaggaa
tacctgaagcagctagcagcatacagagccagccttgtatccaagagctacaatgaccct
gtggatgttaagacatctcagccaccccagctggtcaactccaagccgtcagtgttccat
gggcccagccaggcccactcagctctgtacctaagttctcactatcaccaacaaccagga
atgactcctcagctcaccgccatgcatccgagcctccccagaaacatagcacctaagccc
aataaccaaatgccagtgactgtctccatagccaacatggctgtgtccccaccaccgccc
ctccaaatcagcccacctcttcatcagcatctcagcatgcagcagcatcagccacttgtg
cagcagcctcttgcgagtcagctccccatgcaggtccagaccgccttacactcgcccacc
atgcagcaaggatttactctccaacccgactatcagactattatcaaccctacatctaca
gccgcacaagttgtcacccaagcgatggagtacgtgcgttctgggtgcagaaatcctccc
ccacagccggtggactggagtaccgactactgcagtagtgggggcatgcagagggacaaa
gcgctgtacctcacctga

DBGET integrated database retrieval system