KEGG   Rattus norvegicus (rat): 362489Help
Entry
362489            CDS       T01003                                 

Gene name
Runx1t1, Cbfa2t1
Definition
(RefSeq) RUNX1 translocation partner 1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362489 (Runx1t1)
   05202 Transcriptional misregulation in cancer
    362489 (Runx1t1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    362489 (Runx1t1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NHR2 TAFH zf-MYND DUF3731 Efg1 DUF4434
Motif
Other DBs
NCBI-GeneID: 362489
NCBI-ProteinID: NP_001102127
RGD: 1305490
Ensembl: ENSRNOG00000005673
UniProt: D3ZWZ8
Position
5q13
AA seq 577 aa AA seqDB search
MPDRTEKHSTMPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL
NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGER
VRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNP
AQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRP
CTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRN
RPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGSGSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWK
KAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQ
QEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAPQQGETPAVS
SSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatcgtaccgagaagcactccacgatgccagactcacctgtggatgtgaagacg
cagtctaggctgactcccccagcaatgccgcctcctccgaccactcaaggagccccgaga
accagttcgtttacgccaacgacattaacgaatggcaccagccattcacccacggccttg
aatggcgccccctcaccgcctaatggctttagcaacgggccttcctcttcctcttcctct
tctctggctaatcaacagctgcccccagcctgtggtgctagacaactgagcaagctgaag
cgatttcttactaccctgcagcagtttggcaatgacatttcaccagagattggagaaaga
gttcgcactcttgtactaggactggtgaactctactttgacaattgaagaatttcattcc
aaacttcaagaagctactaacttcccactgagaccttttgtcatcccgtttttgaaggcc
aacctgcccctgctacagcgtgaactcctccactgcgcaaggctagccaaacagaaccct
gcccagtacctcgctcagcacgaacagctgcttctggatgccagcaccacctcccctgtc
gactcctcagagctgcttctcgatgtgaacgaaaacgggaagaggcgaactccagacaga
accaaagaaaatggctttgacagagagcctttgcactcagaacatccaagcaagcgacca
tgcactattagcccaggccagcggtacagtccaaataatggcttatcctaccagccaaat
ggcctgcctcaccccaccccacctccacctcagcattaccgtttggatgatatggccatt
gcccaccactacagggactcctatcgacaccccagccacagggacctcagggacagaaat
agacctatggggttacatggcacacgtcaagaagaaatgattgaccacagactaacagac
agagaatgggcagaagagtggaagcatctcgatcatctgttaaactgcataatggacatg
gtagagaagacgaggcgatccctcactgtactaagacgatgtcaggaagcagaccgggaa
gaactgaattactggatccggaggtacagtgatgctgaggacttgaaaaagggcggcagc
ggtagcagcagccactccaggcaacagagccccgtcaatccggacccagtcgcattagat
gcacatcgggaattccttcacaggcctgcgtctggatacgtgccagaggagatctggaag
aaagctgaggaggctgtgaatgaggtgaagcgacaggcaatgacggagctgcagaaagcc
gtgtctgaagccgagaggaaagcccatgacatgatcaccacagagcgagccaaaatggaa
cgcacggtggctgaagccaagcggcaggccgcagaggatgctctggcagtcatcaaccag
caggaagactccagtgagagttgctggaactgtggccggaaagcaagtgagacctgcagc
ggctgtaacacggcccgatactgtggctctttttgccagcataaagactgggagaagcat
caccacatctgtggacagaccctgcaggccccacagcagggagaaacgcctgctgtcagc
tcctcagtcacgcccagcagtggggctgggagcccaatggacacaccaccagcagccact
ccgaggtctaccacccccggaaccccctccaccatagagacgacgcctcgctag

DBGET integrated database retrieval system