KEGG   Rattus norvegicus (rat): 362489
Entry
362489            CDS       T01003                                 

Gene name
Runx1t1
Definition
(RefSeq) protein CBFA2T1
  KO
K10053  CBFA2/RNUX1 translocation partner 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    362489 (Runx1t1)
   05202 Transcriptional misregulation in cancer
    362489 (Runx1t1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    362489 (Runx1t1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:rno04990]
    362489 (Runx1t1)
Domain-containing proteins not elsewhere classified [BR:rno04990]
 Zinc finger domain-containing proteins
  MYND-type zinc finger domain-containing proteins
   362489 (Runx1t1)
SSDB
Motif
Pfam: NHR2 TAFH zf-MYND Efg1 DUF3731
Other DBs
NCBI-GeneID: 362489
NCBI-ProteinID: NP_001102127
RGD: 1305490
Ensembl: ENSRNOG00000005673
UniProt: D3ZWZ8
Position
5
AA seq 577 aa
MPDRTEKHSTMPDSPVDVKTQSRLTPPAMPPPPTTQGAPRTSSFTPTTLTNGTSHSPTAL
NGAPSPPNGFSNGPSSSSSSSLANQQLPPACGARQLSKLKRFLTTLQQFGNDISPEIGER
VRTLVLGLVNSTLTIEEFHSKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARLAKQNP
AQYLAQHEQLLLDASTTSPVDSSELLLDVNENGKRRTPDRTKENGFDREPLHSEHPSKRP
CTISPGQRYSPNNGLSYQPNGLPHPTPPPPQHYRLDDMAIAHHYRDSYRHPSHRDLRDRN
RPMGLHGTRQEEMIDHRLTDREWAEEWKHLDHLLNCIMDMVEKTRRSLTVLRRCQEADRE
ELNYWIRRYSDAEDLKKGGSGSSSHSRQQSPVNPDPVALDAHREFLHRPASGYVPEEIWK
KAEEAVNEVKRQAMTELQKAVSEAERKAHDMITTERAKMERTVAEAKRQAAEDALAVINQ
QEDSSESCWNCGRKASETCSGCNTARYCGSFCQHKDWEKHHHICGQTLQAPQQGETPAVS
SSVTPSSGAGSPMDTPPAATPRSTTPGTPSTIETTPR
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcctgatcgtaccgagaagcactccacgatgccagactcacctgtggatgtgaagacg
cagtctaggctgactcccccagcaatgccgcctcctccgaccactcaaggagccccgaga
accagttcgtttacgccaacgacattaacgaatggcaccagccattcacccacggccttg
aatggcgccccctcaccgcctaatggctttagcaacgggccttcctcttcctcttcctct
tctctggctaatcaacagctgcccccagcctgtggtgctagacaactgagcaagctgaag
cgatttcttactaccctgcagcagtttggcaatgacatttcaccagagattggagaaaga
gttcgcactcttgtactaggactggtgaactctactttgacaattgaagaatttcattcc
aaacttcaagaagctactaacttcccactgagaccttttgtcatcccgtttttgaaggcc
aacctgcccctgctacagcgtgaactcctccactgcgcaaggctagccaaacagaaccct
gcccagtacctcgctcagcacgaacagctgcttctggatgccagcaccacctcccctgtc
gactcctcagagctgcttctcgatgtgaacgaaaacgggaagaggcgaactccagacaga
accaaagaaaatggctttgacagagagcctttgcactcagaacatccaagcaagcgacca
tgcactattagcccaggccagcggtacagtccaaataatggcttatcctaccagccaaat
ggcctgcctcaccccaccccacctccacctcagcattaccgtttggatgatatggccatt
gcccaccactacagggactcctatcgacaccccagccacagggacctcagggacagaaat
agacctatggggttacatggcacacgtcaagaagaaatgattgaccacagactaacagac
agagaatgggcagaagagtggaagcatctcgatcatctgttaaactgcataatggacatg
gtagagaagacgaggcgatccctcactgtactaagacgatgtcaggaagcagaccgggaa
gaactgaattactggatccggaggtacagtgatgctgaggacttgaaaaagggcggcagc
ggtagcagcagccactccaggcaacagagccccgtcaatccggacccagtcgcattagat
gcacatcgggaattccttcacaggcctgcgtctggatacgtgccagaggagatctggaag
aaagctgaggaggctgtgaatgaggtgaagcgacaggcaatgacggagctgcagaaagcc
gtgtctgaagccgagaggaaagcccatgacatgatcaccacagagcgagccaaaatggaa
cgcacggtggctgaagccaagcggcaggccgcagaggatgctctggcagtcatcaaccag
caggaagactccagtgagagttgctggaactgtggccggaaagcaagtgagacctgcagc
ggctgtaacacggcccgatactgtggctctttttgccagcataaagactgggagaagcat
caccacatctgtggacagaccctgcaggccccacagcagggagaaacgcctgctgtcagc
tcctcagtcacgcccagcagtggggctgggagcccaatggacacaccaccagcagccact
ccgaggtctaccacccccggaaccccctccaccatagagacgacgcctcgctag

KEGG   Rattus norvegicus (rat): 50662
Entry
50662             CDS       T01003                                 

Gene name
Runx1
Definition
(RefSeq) runt-related transcription factor 1
  KO
K08367  runt-related transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04659  Th17 cell differentiation
rno05200  Pathways in cancer
rno05202  Transcriptional misregulation in cancer
rno05220  Chronic myeloid leukemia
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    50662 (Runx1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    50662 (Runx1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    50662 (Runx1)
   05202 Transcriptional misregulation in cancer
    50662 (Runx1)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    50662 (Runx1)
   05220 Chronic myeloid leukemia
    50662 (Runx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    50662 (Runx1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   Runt
    50662 (Runx1)
SSDB
Motif
Pfam: Runt RunxI DUF3037
Other DBs
NCBI-GeneID: 50662
NCBI-ProteinID: NP_059021
RGD: 2283
Ensembl: ENSRNOG00000001704
UniProt: Q63046
Position
11
AA seq 450 aa
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDGGAALASKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDARQIQPSPPWSYDQSYQYLGSITSSVHPATPISPGRASGMTSLSAELSSRLSTAPDLT
AFGDPRQFPTLPSISDPRMHYPGAFTYSPPVTSGIGIGMSAMSSTSRYHTYLPPPYPGSS
QAQAGPFQTGSPSYHLYYGTSAGSYQFSMVGGERSPPRILPPCTNASTGAALLNPSLPSQ
SDVVETEGSHSNSPTNMPPARLEEAVWRPY
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgcgtatccccgtagatgccagcacgagccgccgcttcacgccgccttccaccgcgctg
agccccggcaagatgagcgaggcgctgccgctgggcgccccggatggcggcgccgccctg
gccagcaagctgaggagcggcgaccgcagcatggtggaggtactagctgaccaccccggc
gagctagtccgcaccgacagccccaacttcctctgctccgtgctgcccactcactggcgc
tgcaacaagaccctgcccatcgctttcaaggtggtagcgctgggcgacgttccggatggc
actctggtcaccgtcatggcgggcaatgacgaaaactactcggcggagctgagaaacgcc
accgcggccatgaagaaccaagtggcgagattcaacgacctcaggtttgtcggtcggagc
ggcagaggcaagagcttcactctgaccatcaccgtctttacaaaccccccacaagttgcc
acctaccatagagccatcaaaatcacagtggacggcccccgagaaccccgaagacatcgg
cagaaactagatgatcagaccaagcccgggagtttgtccttttccgagcggctcagtgaa
ctggagcagctgcggcgcacggccatgagggtcagcccgcatcacccagcccccacgccc
aaccctcgggcctccttgaaccactccactgcctttaaccctcagcctcaaagtcagatg
caggatgccaggcagatccagccgtccccaccgtggtcctatgaccagtcttaccagtac
ctggggtccatcacctcttctgtgcacccggcgacacccatttctcccggccgagccagt
ggcatgaccagcctctcagcggaactttccagtcgactctcaacagccccggacctgaca
gccttcggcgacccgcgccagttccccacgctgccgtccatctccgacccgcgcatgcac
tacccaggcgccttcacctactcgcctcctgtcacatcgggcatcggcattggcatgtca
gccatgagctcgacctctcgctaccacacctacctgccgccgccctacccaggctcctcg
caggcgcaggccgggcccttccagaccggctcgccctcctaccacctgtactacggcacc
tcggcaggctcctaccaattctccatggtgggcggcgagcgatcacccccgcgcatcctg
ccgccctgcaccaacgcgtccaccggagccgcgctgctcaaccccagcctccccagccag
agcgacgtggtggaaaccgagggcagccatagcaactcgcccaccaacatgccacccgcg
cgcctggaggaggctgtctggcggccctactga

DBGET integrated database retrieval system