KEGG   Rattus norvegicus (rat): 362490
Entry
362490            CDS       T01003                                 

Gene name
Tmem55a, RGD1306225
Definition
(RefSeq) transmembrane protein 55A
  KO
K13084  phosphatidylinositol-4,5-bisphosphate 4-phosphatase [EC:3.1.3.78]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    362490 (Tmem55a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.78  phosphatidylinositol-4,5-bisphosphate 4-phosphatase
     362490 (Tmem55a)
SSDB
Motif
Pfam: Tmemb_55A C1_1 IBR zinc_ribbon_4
Other DBs
NCBI-GeneID: 362490
NCBI-ProteinID: NP_001020071
RGD: 1306225
Ensembl: ENSRNOG00000006697
UniProt: Q4V888
Position
5q13
AA seq 257 aa
MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPGTSGIPVINCRV
CQSLINLDGKLHQHVVKCTVCNEATPIKTPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN
CRRIINLGPIMLISEEQPAQPALPVQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI
SSVGSALPRRRCCAYVTIGMICIFIGVGLTVGTQDFSRRFHATYVSWAIAYLLGLICLIR
ACYWGAIRVSYPEHGFA
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctgctgacggggtggacgaacgttcgcctctgctgtcagcatcccattcgggcaat
gtcactcccacagccccgccgtacttgcaagaaagcagcccaagagctgaactcccacct
ccgtatacagccatcgccagtccaggaacaagcggtattcccgtcatcaactgtcgcgtg
tgccaatcgctcatcaacctggatggtaaacttcaccagcatgtggttaagtgcacagtt
tgtaatgaagctacgccaatcaaaacccccccgacagggaagaaatatgttagatgccct
tgtaattgtctcctcatttgtaaggacacatctcggcgaataggatgtcctagacccaac
tgtcgacgcataatcaaccttggccccataatgctcatttctgaagagcaaccggctcaa
cctgcgctgccagtccagccggaaggtacaagggtagtgtgcgggcactgcgggaacacg
ttcctgtggatggaactgaggttcaacactctggcaaaatgcccacactgcaaaaaaatc
tcctcggtgggtagcgcccttccccggagacgctgctgtgcatacgtcaccatcggaatg
atatgtattttcattggagttgggttaactgttggcacacaagatttttcaaggcgattt
catgcaacttatgtgtcttgggcaattgcttatctgttaggtttgatttgccttatccga
gcttgttactggggtgcaatcagagtcagttatccagagcacggttttgcttaa

DBGET integrated database retrieval system