KEGG   Rattus norvegicus (rat): 362501Help
Entry
362501            CDS       T01003                                 

Gene name
Topors
Definition
(RefSeq) TOP1 binding arginine/serine rich protein
  KO
K10631  E3 ubiquitin-protein ligase Topors [EC:2.3.2.27]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362501 (Topors)
   03036 Chromosome and associated proteins [BR:rno03036]
    362501 (Topors)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     362501 (Topors)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    362501 (Topors)
  UBL E3 ligases
   362501 (Topors)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    362501 (Topors)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-RING_UBOX zf-rbx1 zf-RING_5 zf-C3HC4_4 zf-ANAPC11 Prok-RING_4 Rad50_zn_hook zf-RING_4
Motif
Other DBs
NCBI-GeneID: 362501
NCBI-ProteinID: NP_001102128
RGD: 1305270
Ensembl: ENSRNOG00000006485
UniProt: D3ZZE0
Position
5q22
AA seq 1042 aa AA seqDB search
MGSQPPPLGSPLSREEGEAPPLAPAEEGRRRSRRVRLRGSCRHRPSLLGRRELASSGPAV
PATASSEIMASAAKEFKMDNFSPKAGTSKLQQTVPADASPDSKCPICLDRFDNVSYLDRC
LHKFCFRCVQEWSKNKAECPLCKQPFDSIFHSVRAEDDFKEYVLRPSYNGSFTAPEVRRF
RYRTTMTRERNASLYSPSSTVSRRTSTPPDSGVLFEGLGISTRPRDVDIPQFMRHMALRG
PTATDERSLRKVQEQDIINFRRTLYRAGVRVRSIEDGGRYRDISAEFFRRNPACLHRLVP
WLKRELTVLFGAHGSLVNIVQHIIMSNVTRYDLESQAFVSDLRPFLLNRTEHFIHEFISF
ARSPFNMAAFDQHANYDCPPSSEEGSRSDSSVITISPDEAEAQELDVNVSTIRQAPWDDE
TPGPSYSNSEQVHVGVSSLLNSSDSSDEELVSGGAASQIQGVQANDDVNNDSDSSSDNCV
IVGFVKPLAERTPELVELSSDSEELGSYEKMETVKTQEQEQSYSSGDSDASRASSPRSVL
GKDEQMGKSHCDSDTRINSKKEEKRSTSLSTPRDSSSTRGDRACSPYNHRHRKGGRSRSS
DSRSQSRSGHDQRNHRKHHGKKRLKNKRSRSRESSSKPRARKDKKRSRTRDSSWSRRSQT
LSLSSGSTSRSRSRSSDHGKRRSRSRNRDRYYLRNNYGSKYKWEYTYYSRNKDRDGYESS
YRRRTLSRAHYSRQSSSPEFRIQSFSERTNARRKNHSERKYYYYERHRSRSVSSNRSRTT
SAVPDRMRNEKPGGKRKYKTRHLEDTNEEAQPSRAFASRVKESHYQKPSKLDGGSKDESD
SFSDSRPSDRETKHKRRKRRARSLSVEIVYEGKATDTSKHHKKKKKKHKKKHRKHHGDNT
SRSPVVITIDSDSDGDAGVKASVECSQSSLPQPGQDEVSTPSSEAFETKDVVTIEDELAV
EDKECDVTALTNDLSTSQAVESSESPPVSVEQTLDVREDSTFASDVESQSSNASIPTEPS
RPLPSPRTSLSSVSPGRDCDMS
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atggggtcgcagccgccgccactggggtctccgctgtctcgcgaggagggtgaagcgccc
cctctggcgcctgccgaggaggggaggcgcagaagccgccgggtacgccttcgcggatcc
tgccgccaccgaccgagcctcctgggccggcgggagctggcttctagcggcccagcggtc
cctgccaccgcgtcctcggagataatggcctcagctgccaaggaatttaaaatggacaac
ttttcacctaaagctggcactagcaaactgcagcagacagtaccggccgatgcatctcct
gattctaagtgtcctatatgcttggatagatttgataatgtgtcttacttagatcgctgc
ctacataagttctgtttccgctgtgtacaagagtggtcaaaaaacaaagccgagtgccca
ctgtgtaagcagccctttgattccattttccattctgtgagggctgaagatgacttcaag
gagtatgtgctaaggccttcctacaatggttcttttaccgcccctgaggttcgaagattc
cgctaccggacaactatgacgagagaacggaacgcctctctttactctcccagtagcact
gtcagtagaagaacaagcactccgccagacagtggagtgctgtttgaagggttaggcatc
tcaacaagacctagagatgttgacattcctcaatttatgagacacatggcattaaggggg
ccaactgctacagatgagaggtctttgcggaaagttcaagaacaagatattattaatttt
aggcgcactctttatcgtgctggtgttcgagttagaagtatcgaagacggtggccgctac
agggatatttcagctgagttcttccgtagaaatccagcttgccttcacagattagttcct
tggttaaaacgtgagcttaccgttctttttggagcccatggctcgttagtcaatattgtc
cagcacatcatcatgagtaatgtcactcgctatgatttggagagtcaggcatttgtgtcg
gacctaagaccatttttgcttaatcgaactgagcattttatacacgagtttatcagtttt
gctagatctcccttcaatatggcagcttttgaccagcatgctaattatgattgccctcct
tcatctgaagaaggcagccgttctgattcttcagttattacaatatcaccagatgaggct
gaagcccaagagctagatgtgaatgtatccaccatcaggcaggcaccatgggatgatgaa
actcctggaccgtcatattcaaattcagagcaagtgcatgttggcgtgtcttccctttta
aattcttcggacagttcagatgaagaacttgtttctggaggagccgcatctcagatacaa
ggagtacaggccaatgacgacgtaaacaatgacagcgattcatcatcagataattgtgtc
attgttgggtttgttaagccattagctgaacggaccccagaacttgttgaactgtcttct
gattctgaggagttgggctcttatgaaaaaatggaaacagtgaagacacaagaacaggag
cagtcttacagttcaggtgatagtgatgctagtcgagcttcatctccgcgttctgtcctt
ggaaaagatgagcagatgggtaaaagccattgtgattcggacacaagaataaactcaaag
aaagaagagaaacgatctacgtcattgtcaactcccagggacagctcatctacaagaggt
gacagggcatgttccccatataaccatcgacataggaagggaggaagatccaggagttca
gattcccgttcccaaagtagaagtggacatgatcagaggaatcacaggaagcatcatggg
aagaaaagattgaagaataagagatccagaagcagggagagtagtagcaaacctagagcg
agaaaggacaaaaagagatcaagaactagagatagcagctggtcaagaagaagccagacc
ctttctctaagtagtggaagcactagtagatcaaggtctcgtagcagtgatcatggcaag
cgaagatcacgaagcagaaatcgagatcgctattatttaagaaataattatggaagcaaa
tacaagtgggaatatacttactatagccgaaacaaggacagagatggttatgagtcgtca
tacaggaggaggactctttcaagagcccattattctagacaatcttcaagtccagaattt
agaattcagtctttttctgaaagaacaaatgccaggaggaagaaccacagtgaaaggaaa
tactactactatgagaggcaccgatcgaggagcgtgtcgagtaataggtcgaggactacg
tcagctgtccctgaccggatgagaaatgagaagcctggagggaagcggaagtacaagacc
cgccatttggaagacactaatgaggaggcacaaccgtctcgtgcatttgcttccagagtg
aaggagagtcattaccaaaagccatcaaaattggacggaggttctaaagacgagagcgat
agcttttcagatagcagaccatcagacagagagacaaaacacaagaggaggaaaaggagg
gcacggagcctaagtgtagagatagtttatgaaggaaaagctacagacacaagcaaacac
cataagaagaagaagaagaaacataagaagaagcataggaaacaccatggagataacact
tcacggtccccggtggttataaccatcgacagtgacagcgacggggatgctggagtgaag
gcaagtgttgagtgtagccagagcagtcttcctcagcctggacaggatgaagtctccact
ccatcctcggaagcatttgaaactaaagatgtcgtcacgatagaggatgagcttgctgtc
gaggacaaggagtgcgatgttacggcacttactaatgacttgagtaccagccaagctgtg
gagagcagtgagtcaccgccagtctcagttgaacagactcttgacgtacgagaagatagc
accttcgcctctgatgtggagagccagtccagtaatgcgtctattcccaccgagccatca
agaccattgccatctccacggacctcattatcctcagtgtctcctggtagagactgtgac
atgtcctga

DBGET integrated database retrieval system