KEGG   Rattus norvegicus (rat): 362505Help
Entry
362505            CDS       T01003                                 

Gene name
Ccl27
Definition
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362505 (Ccl27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    362505 (Ccl27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    362505 (Ccl27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    362505 (Ccl27)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   362505 (Ccl27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 362505
NCBI-ProteinID: NP_001102130
RGD: 1304660
Ensembl: ENSRNOG00000039530
UniProt: D4AAL6
Position
5q22
AA seq 164 aa AA seqDB search
MSRLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSPMPPTSQRLSLEPPRLPLTGWHPW
NKTKEKQEALPLPSSTSCCTQLYRQPLPTRLLRRIVRVELQEADGDCHLQAVVLHLTRRS
VCVHPQNRSLARWLERHGKRLQGTLPSLNPVLQKKMCPSPQKQK
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgattgaggagatacgaggtggcgctggaagcggaggaggagatctactggggc
tgcttctacttttttccttggctgcgaatgtggcgcagggagcggagtccgatgcctcca
acaagccagagactaagtctggaaccccccaggctcccgctgacaggctggcatccgtgg
aacaagactaaggagaagcaagaagccttgccactgccctccagcactagctgctgtact
cagctctataggcaaccactcccaaccagactactgaggaggatcgtccgtgtggagctg
caggaggctgacggggactgccacctccaagctgttgtgcttcacctgactcggcgcagt
gtctgtgttcatccccagaaccgtagcctggctcggtggttagaacgccatgggaaaagg
ctccaggggaccctacccagtttaaatccggtactacaaaagaaaatgtgcccgagcccc
caaaagcaaaagtaa

DBGET integrated database retrieval system