KEGG   Rattus norvegicus (rat): 362511Help
Entry
362511            CDS       T01003                                 

Gene name
Fbxo10
Definition
(RefSeq) F-box protein 10
  KO
K10296  F-box protein 10
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362511 (Fbxo10)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     362511 (Fbxo10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_helix NosD F-box-like F-box F-box_5 Adeno_E1B_55K
Motif
Other DBs
NCBI-GeneID: 362511
NCBI-ProteinID: XP_001071167
RGD: 1305465
Ensembl: ENSRNOG00000012634
Vega: OTTRNOG00000002237
UniProt: A0A1B0GWU1
Position
5q22
AA seq 950 aa AA seqDB search
METGGLPLELWRVILAYLHLPDLGRCSLVCRAWYELILSLDSTRWRQLCLGCTECRHPNW
PNQPDVEPESWREAFKQHYLASKTWAKNALDLESSICFSLFRRKKERRTLSVGPGHEFDS
LGSALAMASLYDRIVLFPGVYEEQGEIILKVPVEIVGQGKLGEVVLLASIDQHCSTTRVC
NLVFMPAWFSPIMYKTTSGHIQFDNCNFENGHIQVHGPGTCQVKFCTFKNTHVFLHNVPL
CMLENCEFVGSENNSVTVEGHPSADKNWAYKYLLGLIKASPIFLPAEDNDFLMSLDLESQ
DQAWSPRTCDIVIEGSQSPTSPVSSSPKPGSKEGEVGSDGERVAQTPDSSDGGLSPSGED
EDDEQLTYRLSYQVQGPRPVLGGSFLGPPLPGASIQLPSCLVLNSLHQELQKDKEAMALA
SSVQGCLIRKCLFRDGKGGVFVCSYGRAKMEGNVFRNLTYAVRCIHNSKIVMLRNDIYRC
RASGIFLRLEGGGLIAGNNIYHNAEAGVDIRKKSNPLILCNQIHHGLRSGIVVLGNGKGV
IRNNQIFSNKEAGIYILYHGNPIVSGNHIFKGRAAGIAVNENGKGLITENVIRENQWGGV
DIRRGGVPILRSNLICFGYSDGVVVGDEGRGLIEGNTIYANKGCGVWMMSSSLPHVSSNH
VSYNGLYGVAVFSQKDGEFPGGHGAQENFSEDGDAILWETELEKEDDPLRRPVTVALVES
NSINHNGASGIFVQSSEALQVTANVIHANGDRGVTIVQSSQLTRVANNSISCNRQSGVKV
EFQCKVELRGNGIYDNRGHGIITKGDGTAVVENDIIGNRGSGLQLLPRSDTKVLKNRIHS
FRAYGIAVRGRVKALVQENIIFQGKTNKTIFQQITNNRECIMQNNKFLVFKKKSDTWRLV
NPPARPHLENSLRGSSAAHSGHKVAAMATRITARVEGGYHSNRSIFCTIL
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgggcggcctccccctggagctgtggcgtgtgatcttagcctacctgcatctt
cctgacctgggccgctgcagtctggtgtgcagggcctggtatgagctgatcctcagcctg
gacagtacccgttggcgacagctgtgtctgggctgcactgagtgccgccaccccaactgg
cccaaccagcccgatgtggagcccgagtcctggagggaggccttcaagcagcactatctt
gcctctaagacctgggctaagaacgcactggacttggagtcttctatctgcttctctctg
ttccgcaggaagaaggagcgacgtaccttgagtgttgggccaggccatgagtttgacagc
ttgggcagtgccttagccatggccagcctctatgatcgaatcgtgcttttcccaggtgtg
tacgaggagcaaggggaaatcatcctgaaggtgccagtggagattgtgggccaagggaag
ttgggtgaggtggtcttgcttgccagcattgaccagcactgctcaaccacccgtgtgtgc
aatcttgtcttcatgccagcctggttctcaccaatcatgtataagaccacatcaggtcac
atccagtttgacaactgcaactttgagaatggacacatccaggtccatggcccaggtacc
tgccaagtgaaattttgtaccttcaaaaatacccatgtctttttgcacaacgtgccctta
tgtatgttggaaaactgtgaatttgtgggcagcgaaaacaactctgtgaccgttgagggt
cacccgtcagccgacaagaactgggcctataagtacctgctgggccttatcaaggcctct
cccatcttcctccctgcagaggacaacgactttttaatgtccttggacttagagagccag
gaccaggcctggagcccaaggacctgtgacattgtcatcgagggcagccagagtcctaca
agtccagtctctagctctccaaagccaggctccaaggagggagaggtgggcagcgatggg
gagagagtggcccagactccagacagcagtgacggcggcctgagccccagcggtgaggat
gaggatgatgagcagctcacctacagactgtcctaccaggtgcagggcccccgccctgtt
ctgggcggctcctttctgggccctcccctacctggagcatccattcagctccccagctgt
ctagttctgaactcactgcaccaggagctgcagaaagacaaggaagccatggcgctagcc
agctccgtgcagggctgccttatccgcaagtgcctcttccgggacgggaagggcggtgtc
ttcgtctgctcttatggccgcgccaagatggaaggaaacgtctttcggaacctgacttat
gcagtgcgatgtatacacaatagcaagatcgtcatgctcaggaatgatatttaccgctgc
cgggcatcaggcatctttcttcgattggagggcggaggcttgatcgctggcaacaatatt
taccacaatgcagaggctggcgtggacattcggaagaaatccaacccactcatcctgtgt
aaccagatccaccacggtcttcgatctggcattgttgtccttggcaatgggaaaggtgtc
atcaggaacaaccaaatcttttctaataaggaggctggcatttatatcctgtaccacgga
aatccgattgtgagcggaaaccacatcttcaaggggcgtgcagctggcatagcagtgaac
gagaatggcaaaggcctcatcacagaaaacgtcatccgcgagaaccagtggggaggtgta
gacatccgccgaggcggcgtcccgatcctcaggagcaacctcatctgctttggctactca
gatggcgtggtggtgggggatgaaggcagaggactgatagaagggaataccatctatgct
aacaaaggatgtggcgtgtggatgatgtcctccagcctgccccatgtctccagcaaccat
gtgagctacaacggcctgtatggggtggcagtgttcagccagaaagacggtgagttccct
gggggccacggggctcaggagaacttcagtgaggacggggacgccatcctctgggagacg
gagctggagaaggaggatgacccactgcgccggcccgtcaccgtagctctcgtggagtcc
aacagtattaatcacaatggagcatcaggaatctttgtccagagcagcgaggcacttcag
gtcaccgccaatgtgatccatgccaatggggacagaggcgtcaccattgttcagagcagc
cagctcacacgagtggctaacaacagcatctcctgcaatcgccagagtggggtcaaggtg
gaatttcaatgcaaggtggagctccggggcaatggtatctatgacaacagaggccatggc
atcattactaagggcgatggtaccgctgttgtggaaaatgacatcatcggcaaccgcggc
agtggactgcagttgctgcccaggtctgacactaaggtactaaagaaccggatccactcc
ttccgggcctatggcattgcagtgcggggccgtgttaaggccctggtacaggagaacatc
atcttccagggcaagaccaacaagaccatcttccagcagatcacaaacaaccgagagtgc
atcatgcaaaacaacaagttccttgtcttcaagaagaagtctgacacctggcgcctggtg
aacccaccagcacggccccacctggaaaactcactccggggctcctctgcagcccacagt
gggcacaaggtggcagccatggcaaccaggatcacagcccgtgtggaaggtggctatcac
agcaaccgtagcatcttctgtaccatcctgtaa

DBGET integrated database retrieval system