KEGG   Rattus norvegicus (rat): 362519
Entry
362519            CDS       T01003                                 

Gene name
Smc2, CAP-E, CAPE, Smc2l1
Definition
(RefSeq) structural maintenance of chromosomes 2
  KO
K06674  structural maintenance of chromosome 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    362519 (Smc2)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin I
    362519 (Smc2)
   Condensin II
    362519 (Smc2)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_21 AAA_15 ATG16 Spc7 AAA_29 BRE1
Other DBs
NCBI-GeneID: 362519
NCBI-ProteinID: NP_001102136
RGD: 1305227
Ensembl: ENSRNOG00000022325
UniProt: D4A5Q2
Position
5q23
AA seq 1191 aa
MYVKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRAS
NLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEAHDEITVTRQVVIGGRNKYLINGV
NANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIA
AQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFL
LAEDTKERSAGELKEMQDKILKLQEVLSENEKKIKALNCEIEELEKRKDKETGGILRSLE
DAFAEAQRVNTKSQSAFDLKKKNLASEETKRKELEKNMAEDSKALAAKEKEVKKLTDGLH
GLQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTGAKQAQ
MKLKHAQQELKNKQAEVRKMDSGYKKDQEAFEAVKKVKEKLETEMKKLNYEDNKEERLLE
KHRQVSRDISNLKGTYEALLAKFPNLRFAYKDPEKNWNRNCVKGLVASLINVKDNSTATA
LELVAGERLYNVVVDTEVTGKKLLEKGELKRRYTIIPLNKISARCIAPETLRVAQNLVGP
NNVHVALSLVDYKPELQKAMEFVFGTTFVCNNMDNAKKVAFDKRIMTRTVTLGGDVFDPH
GTLSGGARSQAASILTKFQELKDVQAELRTKEKELQALEEELAGLKNVAEKYRQLKQQWE
MKTEEGDLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQKKAEEKYEALENKM
KNAEAEREKELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHASNEQQL
DAVNEAIKAYEGQIEIMAAEVAKNKESVNKAQNELMKQKEIISAQDNIIKDKCAEVAKHN
LQNNDSQLKIKELDHSISKHKREADDAAAKVSKMLNDYDWINAEKHLFGQPNSAYDFKTN
NPKEAGQRLQKLQEVKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILATIE
DLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKE
NLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQF
IVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQSQNGRIPKEAKAKGKGPS
NT seq 3576 nt   +upstreamnt  +downstreamnt
atgtatgttaaatcaatcattctcgaaggattcaagtcctatgcacaaaggactgaagtc
aatggttttgaccccctcttcaatgcgatcactggtttgaatggtagtggaaaatccaat
atattggattccatatgctttctcctaggcatctccaacctgtctcaggttcgggcttca
aatttacaagatctggtttataaaaacggacaggctggaatcaccaaagcctctgtttca
atcacttttgataattctgacaaaaagcagagtccattaggatttgaagctcatgatgaa
atcactgtaacaagacaggtggttattggtggcagaaataaatacttaatcaatggagtg
aatgccaacaacaccagagtccaggatctcttttgttctgtgggcctgaacgtgaataac
cctcactttctcatcatgcagggcagaattacgaaagtattaaatatgaaaccaccagag
atattatccatgatcgaagaagctgctggaaccaggatgtatgagtacaaaaaaatagct
gcccagaaaactatagaaaaaaaggaggctaagctgaaagaaataaaaacgatactggaa
gaagagattacgccaacaattcaaaaattaaaagaggaaagatcttcttacttggagtac
cagaaagtgatgcgtgagatcgagcatctgagccgtttatatattgcctatcagtttttg
ctggctgaagataccaaggaacgctcagctggggagctaaaggaaatgcaggataaaata
ttaaagcttcaagaagtactgtcagagaatgaaaaaaagataaaggctctcaattgtgaa
atagaagaattggagaagagaaaagataaggaaactggaggcatcctccgatctttagag
gatgcttttgcagaagctcagcgagttaatactaagtctcaaagtgcatttgacctcaag
aagaaaaacctagccagtgaagaaaccaagcgcaaagagctagagaaaaacatggctgag
gactctaaagcattagcagcaaaggaaaaggaagttaagaagctaaccgatggactgcac
ggccttcaagaagcaagcaataaagatgcggaagctctggccgccgcccagcagcacttc
aatgcagtgtctgctggcttgtccagtaatgaagatggagcagaggcaactctggccggg
cagatgatggcctgtaagaacgacatcagcaaagcgcagaccggggccaagcaggctcag
atgaagttgaaacatgcccaacaggaactgaagaataaacaagcagaagttaggaagatg
gatagtgggtacaagaaggatcaagaagcttttgaagctgtgaaaaaagttaaagaaaaa
cttgaaaccgaaatgaagaagctaaattacgaagacaacaaagaggaaaggcttttggaa
aagcacaggcaggtgtctcgtgacatcagtaatctaaaaggaacctacgaagctctcttg
gccaagtttcccaatcttcgatttgcatacaaggacccagagaagaactggaatcgaaat
tgtgtaaaaggacttgtagcttctctgataaatgtgaaagataattctacagccacagct
ctggaattggtggctggagaacgactctacaatgttgtagtagacacagaggttactggt
aagaaactattagaaaagggggaattgaagcgtcgatacacaataattcctctcaataag
atttcagccagatgtattgctcctgaaactctgagggtcgctcagaatcttgttggtcct
aacaatgttcatgtagctctttccttggttgactacaaaccagaacttcagaaagcgatg
gaatttgtcttcggaacaacatttgtttgtaacaatatggataatgccaaaaaagtggcc
tttgataaaagaataatgaccagaactgtaacccttgggggtgatgtatttgatcctcat
ggaacattgagtggaggtgctaggtcccaggcggcttctattttaaccaagtttcaagaa
ctcaaagatgttcaagctgagctgaggacaaaggagaaagaactgcaggctctggaagag
gaattggctggtcttaaaaatgtcgctgaaaagtatcgccaactgaaacagcagtgggag
atgaagacagaggagggagatttgttgcaaaccaaacttcagcaaagctcttaccataag
cagcaagaagaattagatgcccttaaaaaaaccattgaggaaagtgaggagacattaaaa
aacacaaaagaaatccaaaagaaagctgaagaaaaatatgaggcattggagaataaaatg
aaaaatgcagaagctgaaagagagaaagaactgaaggatgctcagaaaaaactggattgt
gccaaaacaaaggctgatgcatctagcaagaaaatgaaagaaaagcaacaggaggttgaa
gctatcactctggagctagaggagctcaaaagagagcatgcatctaacgaacagcagctt
gatgctgtgaatgaagccatcaaagcctatgaagggcagattgaaataatggcagctgag
gtggccaaaaacaaggaatcagttaataaagctcaaaatgagctgatgaagcaaaaagaa
ataataagtgcccaggacaacataattaaagataaatgtgcggaagtggcaaaacacaat
ttgcaaaacaatgattctcagcttaaaattaaggagttagaccacagcataagcaaacac
aagcgggaagctgacgacgctgctgcgaaggtatccaaaatgttgaatgattatgactgg
attaatgctgagaaacacctctttggccaacctaatagtgcctatgatttcaaaacaaac
aaccccaaagaagctggccagagacttcagaagttgcaagaagtaaaagagaaactaggg
agaaatgtcaacatgagagctatgaatgtgctgacagaagcggaagagcggtataatgat
ttgatgaagaagaaaagaattgtagaaaatgacaaatccaaaatccttgcaactatagaa
gatcttgaccagaagaaaaatcaggccctaaatattgcttggcaaaaggtgaacaaagac
tttggctctattttttctacccttttgcctggtgccaatgctatgcttgcaccaccagaa
gggcagacagttttagatggtctggagttcaaggttgccttaggaaatacatggaaagaa
aacctaactgagcttagtggtggtcagaggtctctggtggctctctcactaatattgtcc
atgctcctcttcaaacctgctccaatttatatcttggacgaggtggatgcggccttagat
ctttctcatacccagaacatcggacagatgctgcgaactcacttcacacattctcaattc
attgtggtatccctcaaagaaggtatgttcaacaatgcaaacgttctcttcaaaaccaag
tttgtggatggtgtttctacagtagccagatttacacagagtcaaaatgggaggattcca
aaggaggcaaaggccaagggcaaaggacccagctga

DBGET integrated database retrieval system