KEGG   Rattus norvegicus (rat): 362522
Entry
362522            CDS       T01003                                 

Gene name
Zfp462, RGD1562123
Definition
(RefSeq) zinc finger protein 462
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf_C2H2_ZHX zf-H2C2_5 zf-H2C2_2 zf-C2H2_4 zf-C2H2
Other DBs
NCBI-GeneID: 362522
NCBI-ProteinID: XP_017449221
RGD: 1562123
Ensembl: ENSRNOG00000032048
UniProt: D3ZFG7
Position
5q24
AA seq 2504 aa
MEVLQCDGCDFRAPSYEDLKAHIQDVHTAFLQPTDVAEDNDDEPLSGSVNAGNQTEVEFS
SIKDEFVIAEDLSGQSATALGSGSYYGHSPGYYGQHITPNPKPTNKFFQCKFCVRYFRSK
NLLIEHTRKVHGAQAEESPTGPPVPGSLNYNIMMHEGFGKVFSCQFCTYKSPRRARIIKH
QKMYHKNSLKESAAPPPAPAPLSDPVVPPVSLQDPCKELPAEVVERSILESMVKPLTKSR
GNFCCEWCSYQTPRRERWCDHMMKKHRSMVKILSNIRQQQEGTNVSEVQNNNEPSPTSNS
TYLSMNAASREMPNTNVSNFRGSVGNSIMRPNSSSTSKFSPMSYPQMKPKSPHNSGLVNL
TERSRYGMSDMTNSSADLDTNSMLNDSSSDEDLNEVDSENGLSVMDHQASGLSAEQLMGS
DGNKLLETKGIPFRRFMNRFQCPFCPFLTMHRRSISRHIENIHLSGKTAVYKCDECPFTC
KSSLKLGAHKQCHTGTSDWDTVNSQSESLSSSLNEGMLSYESPSINGRKSGVMLDPLQQQ
QPPQPPPPLPPPPPPPSQPVQQPPPPQLQSPHQVPPQPQPPPPTQQPQPPTQVPPLHPYK
CTMCSYSTMTLKGLRVHQQHKHSFCDNLPKFEGQPSSLPLENETDSHPSSSNTVKKSQTS
ILGLSSKNNFVAKASRKLANDFPLDLSPVKKRTRIDEIASNLQSKINQTKLQEDAIINVE
DDEEEEDDNEVEIEVELDREEEPTEPIMDVPTAFSAQQIWARDTSESQKEANYRSITHDY
TATNGAEIELTLSEDEEDYYGSSTSIKDHQVSNAALLNTQPPIYGTEHSNENTDFGDSGR
LYYCKHCDFNNKSARSVSTHYQRMHPYIKFSFRYILDPNDHSAVYRCLECYIDYTNFEDL
QQHYGEHHPEAMNVLNFDHSDLIYRCRFCSYTSPNVRSLMPHYQRMHPTVKINNAMIFSS
YVVEQQEGLNAESQTLREILNSAPKSMATSTPVARGGGMPATFNKNTSPKTFTPECENQK
DPSVNTVVVYDCDVCSFASPNMHSVLVHYQKKHPEEKASYFRIQKTMRMVSVDRGSALAQ
LSFEVGAPMSPKMSNMGSPPPPQPPPPDLSIELYYCKHCSYSNRSVVGVLVHYQKRHPEI
KVTAKYIRQAPPTAAMMRGAEGLQDSPRPPAPMQLNRSSSERDCPPVETEMFFCQHCDYG
NRTVKGVLIHYQKKHRDFKANADVIRQHTATIRSLCDRNQKPASCVLLPASGMERDKTKL
RALKCRQCSYTSPYFYALRKHIKKDHPALKATVTSIMRWAFLDGLIEAGYHCEWCIYSHM
EPSGLLLHYQRRHPEHYVDYTYMATKLWAGPDPSSPTLTMSAEAKTYRCRDCAFEAVSIW
DITNHYQAFHPWAMNGDESVLLDIIKEKDGVDKALLAPEELIGAVNCENSLPNPLPEQEA
ECPEDARLSPEKSIHLASANPAISSTPYQCTVCQSEYNNLHGLLTHYGKKHPGMKVKAAD
FAQDVDINPGAVYKCRHCPYINTRIHGVLTHYQKRHPAIKVTAEDFVHDVEQSADITQND
VEETSRIFKQGYGAYRCKLCPYTHGTLEKLKIHYEKYHNQPEFDVFSPSPPKLPVSLEPE
ITTEVSPSQVSMTEEEVGEDPMSTAHFSTSHLVSHTVFRCQLCKYFCSTRKGIARHYRIK
HNNVRAQPEGKNNLFKCALCAYTNPIRKGLAAHYQKRHDIDAYYTHCLAASRTISDKPNK
VIIPSPPKDDSPQLSEELRRAVEKKKCSLCSFQSFSKKGIVSHYMKRHPGVFPKKQHASK
LGGYFTAVYADEHEKPPLMEEEGRSGFERPEVEGEAQDIEWLPFRCIKCFKLSFSTAELL
CMHYTDHHSRDLKRDFVILGSGPRFQNSTFQCKHCDSKLQSTAELTSHLNIHNEEFQKRA
KRQERRKQLLSKQKYADGAFADFKQERPFGHLEEAPKIKERKVVGYKCKFCVEVHPTLRA
ICNHLRKHVQYGSVPAVSAAVKGLRSHERSHLALAMFTREDKYSCQYCSFVSAFRHNLDR
HMQTHHGHHKPFRCKLCSFKSSYNSRLKTHILKAHAGEHAYKCSWCSFSTMTISQLKEHS
LKVHGKALTLPRPRIVSLLSSHAHHSSQKATPAEEVEDSNDSSYSEPPDVQQQLNHYQSA
ALARNNSRVSPVPPSGTAAGTEQKAEAVLHCEFCEFSSGYIQSIRRHYRDKHGGKKLFKC
KDCSFYTGFKSAFTMHVEAGHSAVPEEGPKDLRCPLCLYHTKYKRNMIDHIVLHREERVV
PIEVCRSKLSKYLQGVVFRCDKCTFTCSSDESLQQHIEKHNELRPYKCQLCYYETKHTEE
LDTHLRDEHKVSRNFELVGRVNLDQLEQMKEKMESSSSDDEDKDDEMSSKTEDRELMRFS
DRGAGVNTEKRFPCEFCGRAFSQGSEWERHVLRHGMALHDTDQVSRDEIHTKEMVEDSMQ
LPSIEAKEDDEPIGIDFPLKSETVTICVVAADKSLLENAEAKTE
NT seq 7515 nt   +upstreamnt  +downstreamnt
atggaggtgcttcagtgcgatggctgtgacttccgagccccatcttatgaagatctcaag
gcacacatccaggatgtccacacagcgttcttacagccgacggatgttgccgaggacaat
gatgatgagccactctctgggtccgtgaatgctggtaatcagacagaggtggaattctct
tctataaaggatgagtttgtgattgccgaggatttatcaggtcaaagtgcaactgcattg
gggagtggaagttactatggccacagtccaggatattacggtcagcatattacccctaat
cccaaaccaaccaacaaattttttcagtgcaagttctgcgtgcgctacttcaggtcaaaa
aatctcctcatagaacatactaggaaggtccatggagctcaagctgaagagagtcccact
ggacctcctgtcccaggatccttaaattataatatcatgatgcacgaaggatttggaaag
gtcttttcttgccagttttgcacatacaaatcacctcggagggcaaggataattaagcat
cagaagatgtaccacaaaaacagtttgaaggagtccgcagcaccaccgcctgctcctgct
ccactgtcagaccctgtggttccaccagtgtccttgcaggacccctgcaaggaactgcca
gcggaggtggttgagcgtagcatcttagaatccatggtcaagcctttgaccaagtctcga
ggcaacttctgttgtgagtggtgcagctaccagaccccccgccgagaacgctggtgcgat
cacatgatgaagaaacacagaagtatggtcaagatcctttctaatatcaggcaacagcaa
gaagggactaatgtatctgaagtgcagaataataatgaacccagccccacatccaactcc
acctacctgtccatgaatgctgcaagccgggagatgcccaacactaatgtctccaatttc
aggggctctgtgggcaactccatcatgagacctaattcttcttcaacttccaagttttcc
cctatgtcttatcctcagatgaagccgaagtcacctcataattctggccttgtgaacttg
acagagagatcccgttatggaatgtctgacatgaccaattcatccgctgacctggacact
aacagcatgctaaatgactctagttccgatgaggatttaaatgaggtagacagtgagaat
ggtttaagtgttatggatcaccaggcctcaggactgtctgcagagcagctgatgggctct
gatggcaacaaactgttagagaccaaggggatcccatttcgaaggttcatgaataggttc
cagtgtcccttttgtcctttcctcaccatgcaccgtcgcagcatttcccgtcacatagaa
aatatccacttatctggaaagacagctgtctacaaatgtgacgagtgtccgtttacttgt
aagagctcattaaaactcggggctcataaacagtgtcacacgggtacgtcggattgggat
actgtgaattctcaaagcgaaagtctgtcttcctcattgaatgaaggaatgctatcttat
gagagccccagcatcaacggtagaaagtcgggagtcatgttggatcccttgcagcagcag
cagccaccacagccacctccaccactaccaccaccaccaccaccaccatcgcagccagtg
cagcagcctccaccaccgcagctgcagtcaccacaccaggtgccacctcagccacagccg
ccaccaccaacacagcagccacagccacccacacaggtcccacctttgcacccttacaaa
tgcaccatgtgtagttattccaccatgactctgaaagggctaagagtccatcagcagcac
aaacattcattctgcgacaacttgccaaaattcgaggggcagccctcgagcctgccactg
gaaaatgagacagatagccacccctcttccagcaacactgtgaagaaaagtcagacctca
attcttggattgtcctccaagaataactttgtagctaaggcctctaggaaacttgctaat
gactttcctcttgatttatcacctgtgaagaagagaacaaggattgacgagatagccagc
aatttacagagcaaaatcaaccagaccaaactgcaggaagatgctatcatcaatgtcgag
gacgatgaggaggaagaggatgacaacgaagtagaaatagaggttgaactggacagggaa
gaagaaccaacagaacccatcatggatgttcccactgccttttcagcccaacagatttgg
gccagagacaccagtgaatcccagaaggaggctaactatagaagtatcacccatgattac
actgccaccaatggggccgagatcgagctcacactttctgaagatgaagaagattattat
ggctcttcaacaagcataaaagatcaccaagtgtccaatgcagcgctgctgaacacccaa
ccccctatctatgggacagaacacagtaatgaaaatactgattttggtgactctggaagg
ctttactattgtaaacactgtgactttaataataaatctgcccggagtgttagcactcac
taccagcgaatgcacccatacattaagttcagctttaggtatatcttggaccccaatgat
cacagtgcagtgtacaggtgcctggaatgctatattgactacaccaactttgaagacctc
caacagcattatggtgaacatcacccagaggccatgaatgtactcaactttgaccattcg
gacctgatctaccgatgtcgattttgttcctacacaagcccgaatgtcagaagcctgatg
ccacattaccaaagaatgcatcccacggtgaaaatcaacaatgctatgatcttttcaagc
tatgttgtagagcagcaggaagggctgaatgctgagtcccagaccctgcgggagattttg
aattcagctcccaagagcatggcgacatccacgccggtggctcgtggtggtggtatgcca
gctacatttaacaaaaatacttctcccaagacctttactccagaatgtgaaaaccagaaa
gacccttcggtgaacaccgttgttgtttatgattgtgacgtttgctcgtttgcgagtccc
aacatgcactctgtcttggttcactatcagaagaaacaccctgaagaaaaggcctcgtac
tttaggatccagaaaaccatgcgcatggtgtctgtggacagaggctctgcccttgcccaa
ttatcatttgaggtgggtgctccaatgtctcccaaaatgtccaacatgggttccccaccc
cccccacagcccccaccaccagacctcagtattgagctttactactgcaaacactgctcc
tacagcaatcggtcagttgtgggggtgcttgttcactaccagaaaagacacccagaaata
aaggtcactgccaaatatatcagacaggctcctcccacagctgcaatgatgagaggggct
gaagggctccaagattcccctcggcctcctgcacccatgcagttgaaccggagcagttct
gagagagattgccctcctgtggagactgagatgttcttttgccagcactgtgattatggg
aaccggacggtcaagggcgtcctcattcattatcagaagaagcaccgggacttcaaggcc
aatgccgatgtgatcaggcagcacacagccaccatcagaagcctctgtgaccggaaccag
aagcctgccagttgtgtgcttctccctgcttccggcatggaacgggacaaaacgaaactt
cgagcgctcaaatgtaggcagtgctcgtatacctccccctatttctatgcactgcggaag
catatcaagaaagaccaccctgccctgaaggccacagtcacgtccatcatgaggtgggcg
tttctagatggcttgatagaagctggctaccactgtgagtggtgtatctactcccacatg
gaacccagtggtttgctcctgcattatcaaaggaggcaccctgagcattatgtagattac
acttatatggctaccaaactctgggcggggccagacccatcctctcccactcttaccatg
tcagctgaagccaaaacatacagatgcagggactgtgcttttgaagccgtctctatctgg
gacatcaccaatcattaccaagcgttccacccctgggccatgaatggtgatgaatctgtg
ttgctggatatcatcaaggagaaagatggtgtagacaaggccctcctagcacctgaagag
ttgataggcgctgtgaattgtgaaaacagtctgcccaacccccttcccgagcaggaagcc
gaatgcccagaggatgcaagactttccccagagaaaagcattcatctggcttcagctaat
cctgctatatcttccaccccatatcagtgtacagtgtgccagtccgagtacaacaacttg
catggcctcctcacccattatgggaagaagcatcctgggatgaaagtgaaggctgctgat
tttgcccaggatgttgacatcaacccaggtgccgtctacaaatgcaggcattgtccgtac
atcaacactcgcatccacggcgtcctgacccactaccagaagcgacacccggccatcaag
gtgaccgctgaggactttgtgcatgatgtagagcagtcagctgacataacccagaatgac
gtggaggagacaagtaggattttcaaacaagggtatggtgcctaccggtgcaagctgtgt
ccttatacacatggcacgctggagaaactcaaaatccactatgagaagtaccacaaccag
cctgagtttgatgtcttttccccctctcccccgaagttgccagtgtcccttgagcctgag
ataaccaccgaagtgagcccctcccaggtctccatgacggaggaggaggtgggagaggat
cctatgtccactgctcacttctctacctcgcatctggtctcccacactgtgttccggtgc
cagctctgcaagtacttctgttccacaaggaagggcattgccaggcattaccggatcaag
cacaataatgtccgtgcccagcccgagggcaaaaacaatctcttcaagtgtgccctgtgt
gcctacaccaaccccatccgcaagggactggcagcccactaccagaagcgccacgacatc
gatgcatattacacccactgccttgcagcctccaggaccatcagtgacaagcccaacaag
gtgatcatcccatccccacccaaagatgactctcctcagctgagcgaggaactacggcgg
gctgttgagaagaaaaagtgttccttatgttccttccagtccttcagcaagaaaggcatt
gtgtcccattatatgaagcgacacccaggagtgttcccaaagaagcagcatgccagcaag
ctgggaggctacttcacagccgtctacgcggatgagcatgagaaaccccctctgatggag
gaagaggggagaagcggctttgagaggcccgaggtggaaggcgaagctcaagacattgag
tggctcccattccgctgcatcaaatgcttcaagctgtccttcagcacagcagagctgctg
tgcatgcattacacagaccaccacagcagggacctaaagagggacttcgtcatcctaggc
agcggcccccgcttccagaactccaccttccagtgtaagcactgtgatagcaaattgcaa
agcacagctgagctgacctcacacttgaacattcacaatgaggaattccagaagcgtgcc
aaacgccaggagaggaggaaacagcttttgagcaagcagaaatatgcagatggtgctttt
gcagatttcaaacaagagaggccttttggtcacttagaagaggcaccgaagatcaaggag
aggaaagtggtgggctacaagtgtaagttctgcgtggaagtgcatccaacgctccgggcc
atctgtaaccacctccggaaacacgttcagtatggcagtgtcccggctgtgtcggctgcc
gtgaaggggctgcgttctcatgagaggagtcacctagccttggccatgtttacccgagag
gacaagtacagctgccagtattgctcctttgtttctgcattcagacacaacttggatcgc
catatgcagacccatcatggacaccataaaccgttccgctgcaaactctgctctttcaaa
tcctcctacaacagccggttgaagacacacatcctcaaagcccatgctggtgaacatgcc
tacaaatgttcttggtgctcattttccaccatgacaatcagccagctgaaggaacactcc
ctcaaggtccacggaaaagccctgacccttccccggccacggattgtcagtctcctctcc
tcacatgcccaccattcctctcagaaggctactccagccgaagaagtggaagactccaat
gactcctcttactcggagccccccgatgttcaacagcagctgaatcactatcagtcagct
gccctggcaagaaacaacagccgtgttagccctgtgcctccttctgggactgctgctggc
actgaacagaaggcagaagctgttcttcactgcgaattctgtgaattctcctctggctac
atccagagcatcaggcgccattaccgggacaagcatggtgggaagaagcttttcaaatgc
aaagactgctctttttacaccggctttaagtctgcttttactatgcatgtggaagctggg
cactcggcagtcccggaggaaggccccaaagatctccgctgtcctctctgcctctatcat
accaaatacaaacgcaacatgatcgaccacatagtgctgcaccgagaagagcgcgttgtc
cccattgaagtgtgccgttccaaactgtcaaaatacttgcagggagtagttttccgctgc
gataagtgtaccttcacctgctccagtgatgagagcctccagcagcacatagaaaagcac
aatgaactgagaccttacaaatgccagctctgctactatgagaccaagcacacagaggaa
ctggacactcaccttcgcgatgagcataaggtcagccgtaactttgagctggttggacgg
gttaacctggatcagctggaacagatgaaggagaagatggagagctccagcagtgatgat
gaggacaaggacgacgaaatgagcagcaagactgaggacagagagctgatgagattttct
gaccggggggctggtgtgaacactgagaagcggtttccatgtgaattctgtggacgggca
ttctcacaaggctctgagtgggaaagacacgttttgagacatggcatggcattgcacgat
actgaccaagtgagcagggatgaaatccacacaaaggagatggtggaggacagtatgcag
ctgccctccatagaggccaaggaagacgatgagccaatcgggatagactttcccttaaag
agtgaaacagtaaccatctgtgtggtagctgccgacaaatctctcctggagaatgcagag
gccaaaaccgaataa

DBGET integrated database retrieval system