KEGG   Rattus norvegicus (rat): 362533
Entry
362533            CDS       T01003                                 

Gene name
Tle1
Definition
(RefSeq) transducin like enhancer of split 1
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: TLE_N WD40 ANAPC4_WD40 HALZ APG17
Other DBs
NCBI-GeneID: 362533
NCBI-ProteinID: NP_001166904
RGD: 1309237
Ensembl: ENSRNOG00000005882
UniProt: D3ZCM7
Position
5q31
AA seq 770 aa
MFPQSRHPTPHQAAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRH
YVMYYEMSYGLNIEMHKQTEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELN
AIIGQQQLQAQHLSHGHGPPVPLTPHPSGLQPPGIPPLGGSASLLALSSALSGQSHLAIK
DDKKHHDAERHRDREPGTSNSLLVPDSLRGTDKRRNGPEFSSDIKKRKVDDKDNYDSDGD
KSDDNLVVDVSNEDPSSPHASPTHSPRENGIDKNRLLKKDASGSPASTASSGSSSSLKSK
EVNLHEKANTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAMEPLVNQAAAGLRTPL
AVPGPYPAPFGMVPHAGMNGELTSPGAAYAGLHSMSPQMSAAAAAAAAAVVAYGRSPMVG
FDPPPHMRVPSIPPNLAGIPGGKPAYSFHVTADGQMQPVPFPPDALIGPGIPRHARQINT
LNHGEVVCAVTISNPTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLP
DGCTLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGNIAV
WDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLREGRQLQQHDFTSQI
FSLGYCPTGEWLAVGMESSNVEVLHVNKPDKYQLHLHESCVLSLKFAYCGKWFVSTGKDN
LLNAWRTPYGASIFQSKESSSVLSCDISVDDKYIVTGSGDKKATVYEVIY
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgttccctcagagccggcacccaacgccgcaccaggctgcaggccagccctttaagttc
actatcccggagtccctggaccggattaaagaggaattccagttcctgcaggcgcagtat
cacagtcttaaattggagtgtgagaaattggcaagtgaaaagacagaaatgcagagacac
tacgtgatgtattatgaaatgtcatatggattaaacattgaaatgcataaacagaccgaa
atcgccaagagattgaataccatttgtgcacaagtcatcccatttctgtctcaggaacat
caacaacaggtggcccaggctgtcgaacgtgccaaacaggtgaccatggcagagttgaat
gccatcatcgggcagcagcagttgcaagctcagcatctctcccatggccatggaccccca
gtacctctcacgcctcacccttcaggacttcagcctcctggcatcccgccccttgggggc
agtgccagccttctcgcgctgtctagtgctctgagtgggcagtctcacttggcaataaaa
gatgacaagaagcaccatgatgcagagcgccacagagacagagagccgggcacgagtaat
tccctcttggtcccagacagcctaagaggcacagataaacgcagaaatggtccagagttt
tccagtgacatcaaaaaacggaaggtggatgataaggataactatgacagtgatggggac
aagagtgacgacaacttagttgtggatgtgtctaatgaggacccttcttctccacatgca
agccccacacactcaccccgggaaaacggaattgacaaaaaccgtctgttgaagaaagat
gcttcaggtagcccggcatccacagcctcctctggaagttcctcatccctgaaatccaaa
gaagtgaacctgcatgaaaaagccaacacgcctgttctgaaatccagcacaccaacgcct
cggagtgacatgccaaccccgggcaccagcgctactccaggcctccgtccaggtctcggc
aagcctccagccatggagccccttgtcaaccaagcagcagctggcctgaggacgcccctg
gcagtgcctggcccataccctgccccctttggcatggtgccccatgcaggcatgaacgga
gagctgaccagccctggcgctgcctatgcaggtctacacagcatgtctccacagatgagc
gctgcagctgctgcagctgctgctgctgtggtggcctatgggcgctccccaatggttggt
tttgatcctcctcctcacatgagagtaccttctatccctcccaacctggcaggaatacct
ggcgggaaaccagcatactccttccacgttacggctgacggacaaatgcagcctgtccct
tttccccctgacgccctcattggacctgggattccccgacatgctcggcagatcaatacc
ctcaaccacggggaggtggtgtgtgcagtgaccatcagcaaccccacaaggcacgtgtac
acaggtggcaagggctgcgttaaggtctgggacatcagccaccctggcaacaagagcccc
gtctctcagctggattgtctgaacagagataactacatccgttcctgtaaattgctacct
gatggctgtactctcatagtgggaggggaagccagtactctatccatctgggacctggca
gctccaactccccgaattaaggcagagctgacatcctcagcccctgcctgctatgctctg
gccatcagccctgactccaaggtctgcttctcatgctgcagtgatggcaacatcgcagta
tgggacctgcacaaccagaccctggtgaggcaattccagggccacacagacggagccagc
tgtattgacatttctaatgatggcaccaagctctggacaggcggtttagacaacactgtg
aggtcctgggacctgagagaaggaaggcagctgcagcagcatgatttcacttcacagatc
ttctccttgggatactgcccaactggggagtggcttgccgtgggcatggaaagcagcaac
gtggaagttctgcatgtgaacaagcctgacaaataccagcttcacctccacgagagttgt
gtgctgtccctaaaatttgcttattgtggcaagtggtttgtgagtactggaaaagacaac
ctcctaaatgcctggcggacaccatatggagccagcatattccagtccaaagaatcttca
tcagtgcttagctgtgacatctctgtggatgataaatacatagtcactggctcaggggac
aaaaaggctaccgtttatgaggtcatctactga

DBGET integrated database retrieval system