KEGG   Rattus norvegicus (rat): 362557
Entry
362557            CDS       T01003                                 

Gene name
Ndc1, Tmem48
Definition
(RefSeq) NDC1 transmembrane nucleoporin
  KO
K14315  nucleoporin NDC1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03013  RNA transport
rno05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    362557 (Ndc1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    362557 (Ndc1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    362557 (Ndc1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     362557 (Ndc1)
SSDB
Motif
Pfam: Ndc1_Nup DUF5134
Other DBs
NCBI-GeneID: 362557
NCBI-ProteinID: NP_001020194
RGD: 1560173
Ensembl: ENSRNOG00000010620
UniProt: Q6AXN4
Position
5q34
AA seq 673 aa
MATAASGPCAGGSPRDILWRVLGWRIVTSVVWSVLLLPVCITAFIVFSSIDLFHPIQWLS
DSLNEFYSSQVIFYLLLLAVVIIIISIFNVEFYTVVPSIPGSRLALIARILHPQQLTHSF
IHAVMGMAVAWCAAIMTKGQSRSLVVPCTGTESLDSPAAQTCMNEYHLFFLLSGAFMGYS
YSLLYFINNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFMVRNFCIVYYFFGHIPK
AWISTALDLRTDEQAHRPLDTIGGLLNVSLLYHVWLCGVFLLMTWYISWILFKIYATEAY
MFPVQPPFAEESDECLPKVLNSNPPLIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHP
HNWTAISRECLSLLNDMTQKLVLYQEAAATNGRMYSSYSVEPKRLSSPEETAFQTPKPSQ
MPSVPPLVKTSLFSPKLSTPDGSSPFGTPFGSSVVNRMAGIFDVNTCCGSPQSPQLVRRG
PRLWTHTSDQQVSAVSNPSPCASVTAEGKTVRQPSVLYSWIQNKREQIKNFLSKRVLIMY
FFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILNTLLTLQEA
VDKYFKLPHASSKPPRTSGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASAE
HQKRLQQFLEFKE
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggccacggctgcgagcgggccctgcgccggcgggtcaccgcgggacatcctttggcgc
gttttgggctggaggatagttactagtgtcgtttggtcagtgctgcttctccctgtctgc
atcacagcatttatagtcttcagcagcatcgatttattccaccctatacagtggctgtca
gattctctcaatgagttctatagttcccaagtaatcttttacctcctgctgctggccgtg
gtcattataataataagtattttcaatgtggagttctatacagttgtgccctccataccc
ggctcccgactggcgctgatagcacggatccttcaccctcagcagctcacgcactccttc
atacacgctgtgatgggaatggcagtggcttggtgtgcggccatcatgaccaagggccag
tccaggtctctggtagttccctgcactggaacggagagcttagatagccctgctgctcaa
acctgcatgaatgaatatcatctgtttttcctactgtctggagcattcatgggctatagc
tatagtcttctgtatttcattaacaacatgaattatcttccgtttcctattatacagcag
tacaaatttttgcgtttccggagatctctcctcttactagttaaacatagctgtgtggaa
tccctgttcatggtcagaaatttctgcattgtatattatttttttggtcatattcccaaa
gcatggattagcactgctctggaccttcgcacagacgagcaggcccacaggcctcttgac
acgataggcggtctcctgaacgtctcattgctctaccatgtctggctgtgtggtgtcttt
ctcttgatgacttggtatatctcatggatactcttcaaaatctatgccacagaggcttat
atgttccctgttcagccaccatttgcggaagaatcagatgaatgccttcctaaagtctta
aatagcaatcccccactcatcataaagtatttggccttacaggacctgatgttgctttct
cagtattctccttctcgaaggcaagaagttttcagcctcagccaaccaggtggacatccc
cacaattggactgctatttcgagggagtgtttgagtcttttaaatgatatgactcagaag
ctggttctctaccaagaagctgctgctacgaatgggcggatgtattcctcatactcagtg
gaacccaagagactgagttctccagaagaaactgcttttcagactccaaaacctagccag
atgccttccgtgccgccattagttaaaacctcattgttttctccaaaattaagtacacct
gacggttcaagtccttttgggactccgtttggctccagtgtagtgaaccgaatggctgga
atttttgatgtaaacacctgctgtggatctccccagagtcctcagcttgtcagaagaggg
ccgagactgtggactcacacttctgatcagcaagtgtctgcagtctctaatccctctcct
tgtgcctctgtcactgctgagggcaagacagtgaggcagcccagtgtgctctactcgtgg
attcagaataaacgggagcagattaagaatttcttgtcgaaacgggtgctgataatgtac
tttttcagtaagcatccagaggcctccattcaggctgttttttcagatgcccaaatgcat
atttgggctttagaaggtctgtctcacttagtagcagcatcatttacagaagatagattt
ggagttgtccagaccacgctcccagctatccttaatactttgctgactctgcaggaggct
gttgacaaatacttcaagctgccccatgcttctagtaaaccaccccgaacttcaggaagc
ctcgtggacacatcctacaaaacattaagatttgctttcagggcctcactgaaaactgct
atctaccgtataaccaccacgtttggtgaacatctgaatgctgtgcaagcatctgcagaa
catcagaaaagacttcaacagttcttggagttcaaagaatag

DBGET integrated database retrieval system