KEGG   Rattus norvegicus (rat): 362567Help
Entry
362567            CDS       T01003                                 

Gene name
Pomgnt1
Definition
(RefSeq) protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-)
  KO
K09666  beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00515  Mannose type O-glycan biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    362567 (Pomgnt1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    362567 (Pomgnt1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     362567 (Pomgnt1)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  O-Glycan
   362567 (Pomgnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GNT-I ILEI
Motif
Other DBs
NCBI-GeneID: 362567
NCBI-ProteinID: NP_001007748
RGD: 1359396
Ensembl: ENSRNOG00000023455
UniProt: Q5XIN7
Position
5q35
AA seq 660 aa AA seqDB search
MDDWKPSPLIKPFGARKKRSWYLTWKYKLTNQRALRRFCQTGAVLFLLVTVIVNIKLILD
TRRAISEANEDPEPEQDYDEALGRLESPRHRGSSPRRVLDVEVYSSRSKVYVAVDGTTVL
EDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVLFLNMVAPGRVLICTVKDE
GSFHLKDTAKALLRSLGSQAGPALGWRDTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLL
KTDVPLSSAEEAECHWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLPDNKVL
NVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQHTP
ISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLY
CISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMR
MPEQRRGRECIIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPGVQLRNVDSLKKEA
YEVEIHRLLSEAEVLDHSKDPCEDSFLPDTEGHTYVAFIRMEKDDDFTTWTQLAKCLHIW
DLDVRGNHRGLWRLFRKKNHFLVVGVPASPYSVKKPPSVTPIFLEPPPKEEGAPGAAEQT
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggatgactggaagcctagtcccctcatcaagccctttggggctaggaagaaacggagc
tggtatcttacctggaagtataaactgacaaaccagcgggccctgcgaagattctgtcag
acaggagctgtgcttttcctgctggtgactgtcattgtgaacatcaagttgatcctagac
actcggagagccatcagcgaggccaatgaagaccctgaaccagagcaagactacgatgag
gccctaggacgcttagagtcccctcggcacagaggcagcagtccccgacgcgtgctggat
gtggaagtatactccagtagaagcaaagtgtatgtggcggtagatggcactacggtgcta
gaggatgaggcccgggagcagggccgaggcatccatgtcatcgtcctcaaccaggccacg
ggccacgtgatggcaaagcgtgtgtttgacacgtactctcctcatgaggatgaggccatg
gtgctattcctcaacatggtggcgcccggccgtgtactgatctgcacagttaaggatgag
ggctccttccacctcaaggacacagcaaaggctctgctgaggagcctgggaagccaggca
ggccctgcccttggctggagggacacctgggccttcgtgggacgaaaaggaggtcctgtt
cttggcgagaagcattctaaatctcctgccctctcctcctggggtgacccagtcctgctg
aagacagatgtgccactcagctcagctgaagaggctgagtgtcactgggcagatacagag
ttgaaccgccgccgcaggcgcttctgcagcaaagtcgagggctacgggagcgtgtgcagc
tgcaaggacccaacacctattgagttcagccctgacccacttccagacaataaagtcctc
aatgtgcctgtggctgtcattgcagggaaccggcccaattacctgtacaggatgctgcgc
tctctgctgtcagcccaaggggtatctccacagatgataacagtcttcattgatggctac
tatgaggagccaatggatgtggtggcactgtttggtctgagaggcatccagcacactccc
atcagcatcaagaacgcccgtgtgtctcagcactacaaggccagcctcactgccactttc
aacctgtttccggaggccaagtttgctgtggttctggaagaggacctggacatcgctgtg
gactttttcagtttcctgagccagtccatccacctgctggaggaagatgacagcctgtac
tgcatctctgcttggaatgaccaggggtatgaacacacagctgaggatccagcactactg
taccgtgtggagaccatgcctgggttgggatgggtgctcaggaaatctctatacaaggag
gagcttgagcccaagtggcccacaccagaaaagctgtgggactgggacatgtggatgcgg
atgccggaacagcgccgtggccgtgagtgcatcatcccggatgtttcccgatcctaccac
tttggcatcgtgggcctcaacatgaatggctactttcatgaggcctacttcaagaagcac
aagttcaacacagtcccaggtgtccagctcaggaatgtagacagtctgaagaaagaagct
tatgaagtggaaattcacaggctgctcagtgaggccgaggttttggaccacagcaaggac
ccttgtgaagactccttcctgccagacacagagggccatacctatgtggcatttatccgg
atggagaaagatgatgacttcaccacctggactcagcttgccaagtgcctccacatttgg
gatctggacgttcgtggcaaccaccggggcctgtggagattatttcggaagaagaaccac
tttttggtggtgggggtcccagcctccccttactcagtgaagaagccaccctcagtcacc
cctattttcctggagccacccccaaaggaagaaggagccccaggggctgctgaacaaaca
tga

DBGET integrated database retrieval system