KEGG   Rattus norvegicus (rat): 362584
Entry
362584            CDS       T01003                                 

Gene name
Col9a2
Definition
(RefSeq) collagen type IX alpha 2 chain
  KO
K08131  collagen type IX alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04151  PI3K-Akt signaling pathway
rno04510  Focal adhesion
rno04512  ECM-receptor interaction
rno04974  Protein digestion and absorption
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    362584 (Col9a2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    362584 (Col9a2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    362584 (Col9a2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    362584 (Col9a2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    362584 (Col9a2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:rno00535]
    362584 (Col9a2)
Proteoglycans [BR:rno00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   362584 (Col9a2)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 362584
NCBI-ProteinID: NP_001102145
RGD: 1307029
Ensembl: ENSRNOG00000011502
UniProt: D3ZNT5
Position
5q36
AA seq 688 aa
MTALPAPRSLLLFLQVLWLALAQIRGPPGEPGLPGPPGPPGVPGSDGIDGDKGPPGKVGP
PGSKGEPGKPGPDGPDGKPGIDGLMGAKGEPGPMGTPGIKGQPGLPGPPGLPGPGFAGPP
GPPGPVGLPGEIGTPGPKGDPGPEGPSGPPGPPGKPGRPGTIQGLEGSADFLCPTNCPAG
VKGPQGLQGVKGHPGKRGILGDPGRQGKPGPKGDVGASGEQGIPGPPGPQGIRGYPGMAG
PKGEMGPRGYKGMVGSIGAAGPPGEEGPRGPPGRAGEKGDVGSQGARGPQGITGPKGTTG
PPGIDGKDGTPGIPGMKGSAGQVGRPGSPGHQGLAGVPGQPGTKGGPGDKGEPGQQGFPG
ISGPPGKEGEPGPRGETGPQGIMGEKGDQGERGPVGQPGPQGRQGPKGEQGSPGIPGPQG
LPGIKGDKGSPGKTGPRGGVGDPGVAGLPGEKGEKGLSGEPGLKGQQGVRGEPGYPGPSG
DAGAPGVQGYPGLPGPRGLVGDRGVPGQPGRQGVVGRAASDQHIVDVVLKMIQEQLAEVA
VSAKREALGATGMVGLPGPPGPPGYPGKQGPNGHPGPRGIPGIVGAVGQIGNTGPKGKRG
EKGDQGEMGRGHPGMPGPPGIPGLPGRPGQAINGKDGDRGSPGAPGEAGRPGRPGPVGLP
GFCEPAACLGASAYTSARLTEPGSIKGP
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgaccgccttgccagcgccccgcagcctcctccttttcctccaggtgctgtggctcgcc
ctggctcagatcagaggtccaccaggggagccgggtcttccagggccaccagggccacca
ggagtgcctggttcggatggcatcgacggtgacaaggggcctccaggtaaagttggtcct
ccgggatccaaaggagagcctggcaaaccggggccagatggtccagatgggaagcctggc
attgatggtttaatgggagccaagggagagcctggccccatgggaacccctggaatcaag
ggccagcctgggctcccagggccccctggcctgccgggccctggttttgctggacctccg
ggaccacctggacctgttggcctccctggtgagattggaaccccaggccccaagggggat
ccagggccagagggaccatcagggcccccaggaccccctgggaaaccaggccgaccagga
accatccagggcctggaagggagtgcggatttcttgtgtccaaccaactgtcctgctggt
gtgaaaggtccccagggtctgcaaggagtgaagggccatccaggcaaacgggggattctg
ggtgatcctggtcgccaggggaagccgggccccaagggagatgtgggtgcctctggagaa
caaggtatccctggaccaccgggtccccaaggcatcaggggctacccaggcatggcagga
cccaagggagagatgggtcctcgtggatataaaggcatggtgggctccatcggggctgct
gggccaccgggtgaagagggcccaagggggccaccaggccgagcgggtgagaagggggat
gtggggagccaaggtgcccgaggaccccaggggataacaggcccaaagggaacaactggt
ccaccaggcattgatggcaaggatgggaccccgggcatacctggcatgaagggcagtgca
ggacaggtgggacggccaggaagcccaggccaccagggcttagcgggtgtgccaggtcag
cctggaacaaaaggaggccccggagacaagggtgaacccggccagcagggcttcccggga
atctctggtccccctgggaaagaaggggagccagggcctcgaggagaaactggtccacag
ggcatcatgggagagaagggtgaccagggtgagagagggccagtggggcagccaggccct
caaggacgacagggccccaagggagagcagggatctccaggaattccaggaccccaaggc
ttgccaggcatcaaaggagataagggttccccagggaagaccgggccccgaggtggagtg
ggtgacccgggggtggccggcctcccaggagagaaaggagagaagggcctgtcaggcgag
ccagggcttaagggacagcaaggagttcgtggagagccgggctaccctggccctagcgga
gatgctggtgccccaggagtgcagggctatcctgggcttcccgggccccgaggactggtg
ggagatcgaggcgtgccaggacaaccggggagacagggtgtggtgggccgagctgccagt
gaccagcacatcgtggatgtggtgctgaagatgattcaagagcaacttgcagaggtagct
gtgagtgccaagcgagaagccctgggtgcaacagggatggtgggccttccaggacctcct
gggccccctggatatccaggcaaacagggacccaatgggcaccctggcccccgaggcatt
cctggcattgtgggagctgtgggtcagattggcaacactggacccaagggaaagcgtgga
gagaagggagatcaaggagaaatgggacgtggccatcccgggatgcctgggccaccaggg
atcccaggtcttcctggccggcctggccaggccatcaacggcaaggatggagacagaggg
tccccaggggccccaggagaggctgggcggcctgggcggccgggcccagtggggctccca
ggcttttgtgagcctgctgcctgcttgggagcctcagcctatacctctgctcgcctcacg
gagcctgggtctatcaaggggccatga

DBGET integrated database retrieval system