KEGG   Rattus norvegicus (rat): 362586Help
Entry
362586            CDS       T01003                                 

Gene name
Trit1
Definition
(RefSeq) tRNA isopentenyltransferase 1
  KO
K00791  tRNA dimethylallyltransferase [EC:2.5.1.75]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:rno01006]
    362586 (Trit1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:rno03016]
    362586 (Trit1)
Enzymes [BR:rno01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.75  tRNA dimethylallyltransferase
     362586 (Trit1)
Prenyltransferases [BR:rno01006]
 Compound prenylation
  tRNA dimethylallyltransferase
   362586 (Trit1)
Transfer RNA biogenesis [BR:rno03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    362586 (Trit1)
 Prokaryotic Type
    362586 (Trit1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IPPT IPT zf-C2H2_jaz AAA_33 AAA_28 AAA_25 AAA_18 AAA_16 AAA_22 KTI12 Hpr_kinase_C ABC_tran RNA_helicase AAA_23 Cytidylate_kin AAA IstB_IS21 PRK zf-met
Motif
Other DBs
NCBI-GeneID: 362586
NCBI-ProteinID: NP_001102146
RGD: 1304781
Ensembl: ENSRNOG00000014274
UniProt: D4A175
Position
5q36
AA seq 479 aa AA seqDB search
MAAAAAARAVPVSSGFRGLPRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKVSAQEQKMCRHHMISFVDPLVTSYTVVDFRNRATALISLRKLSTHPWRVPS
GDIFARDKIPIVVGGTNYYIESLLWKVLVTTKPQGMGTGKAVDRKVELEKEDGHELHKRL
SQVDPEMAAKLHPHDKRKVARSLQVFEETGVSHSEFLHRQHAEEGGGPLGGPLKFPNPCI
LWLHADQADERLDKRVDDMLAAGLLEELRDFHRRYNLKNVSEDSQDYQHGIFQSIGFKEF
HEYLTTEGKCTPETSNQLLKKGVEALKQVTKRYARKQNRWVRNRFLSRPGPSVPPVYGLE
VSDVSKWEEFVLEPALSIVQSFIQGSKPTATPVKIPYSETENKRSYHMCDLCDRIIIGDR
EWAAHTKSKSHLHQLKKRRKLDLDAVSALGSQSNSPDSELERKEGESSGQRDQELKASV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcggctgcagcacgagcggttcctgtgagctctggattccgaggcctgcca
cgaacactgccacttgtagtgattctcggggctactggcactggcaagtccactctggct
cttcaattaggccagcggctcggcggcgagatcgtcagcgccgactccatgcaggtctat
gaagggctagacatcatcaccaataaggtctctgcccaggagcagaagatgtgccggcac
cacatgatcagctttgtggatccactcgtgaccagctacaccgtggtagactttaggaac
agagccactgccctgatatccttaaggaaacttagcacccacccctggagggttcctagt
ggtgatatttttgctcgagacaaaattcctattgtggtgggaggaaccaattattacatt
gagtctctgctctggaaagttcttgtgactaccaagccccaggggatgggcactgggaaa
gcggttgatcggaaagtagaacttgaaaaggaagatggtcatgaactccataaacggcta
agccaggtggatccagaaatggctgccaagctacacccacatgacaaacgcaaagtggcc
aggagcttgcaagtgtttgaagaaacaggagtctctcacagtgaattccttcatcgtcaa
cacgcagaggaaggcggtggtcctcttggaggccctctcaagttccctaacccatgcatc
ctctggcttcatgctgaccaggcagatgagcgcctggataagagagtggacgacatgctt
gctgccggactcttggaagagctgagagattttcacagacgctataatcttaagaacgtt
tcagaagatagccaggactatcaacatggtatcttccagtcaattggcttcaaggaattt
cacgagtacctgaccactgaggggaaatgcacaccagagactagtaaccagcttctaaag
aaaggggttgaggctctgaaacaagtaactaagagatatgcccggaaacagaaccgatgg
gttagaaaccgctttttgagcagacctggtcccagtgtccccccggtatatggcttagaa
gtatctgatgtttccaagtgggaggagtttgttctggagcctgctctcagtatagtccag
agtttcatccagggtagcaaacctacagccactccagtgaagataccatacagtgaaact
gagaacaagagaagttaccacatgtgtgacctttgtgaccggatcatcattggggaccgg
gaatgggcagcacatacaaaatccaaatctcacttgcaccaattgaagaaaagaagaaag
ttggacttggacgctgtcagtgccttaggaagccaaagtaattcaccagacagtgagctg
gaacgcaaagagggggaatcctcaggacagcgtgatcaagagctaaaggccagtgtttga

DBGET integrated database retrieval system