KEGG   Rattus norvegicus (rat): 362590Help
Entry
362590            CDS       T01003                                 

Gene name
Inpp5b
Definition
(RefSeq) inositol polyphosphate-5-phosphatase B
  KO
K01099  inositol polyphosphate 5-phosphatase INPP5B/F [EC:3.1.3.36]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    362590 (Inpp5b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    362590 (Inpp5b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362590 (Inpp5b)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.36  phosphoinositide 5-phosphatase
     362590 (Inpp5b)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    362590 (Inpp5b)
 Endocytosis
  Clathrin-mediated endocytosis
   Inositol 5-phosphatases
    362590 (Inpp5b)
  Rab GTPases and associated proteins
   Rab associated proteins
    362590 (Inpp5b)
 Protein recycling
   Other Rab GTPase associated proteins
    362590 (Inpp5b)
 Endosome - Golgi transport
   Rab associated proteins
    362590 (Inpp5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: INPP5B_PH RhoGAP Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 362590
NCBI-ProteinID: NP_001094225
RGD: 1311511
Ensembl: ENSRNOG00000048506
UniProt: D4A2N2 Q4G006
Position
5q36
AA seq 916 aa AA seqDB search
MDQSVAIQETLVEGEYCVIAVQGVLCKGDSRQSRLLGLVRYRLENDVQEHALFLYTHRRM
AITGDDVALDQIVPLSKDFMLEEVSPDGELYILGSDVTVQLTTAELRLVFQLPFGSHTRT
FLQEVARACPGFDPETRDPEFLWLCRHRCAESEAESPKPREWNSDPGTRSGFAPIGGGGY
NVDSSRPNGRGLLPLDQSSGARCPDKPENSLTRQNRSKAEITDMVRSSTITVSDKAHILS
MQKFGLRDTMVRSHLLQKEGEYTYIQNFRFFVGTYNVNGQSPKECLRPWLSSDTKAPDVY
CVGFQELDLSKEAFFFHDTPKEEEWFKAVSESLHPDAKYAKVKLIRLVGIMLLLYVKQEH
AAYISEVEAETVGTGIMGRMGNKGGVAIRFQLHNTSICVVNSHLAAHTEEYERRNQDYRD
ICSRMQFSQVDPSLPPLTISKHDVILWLGDLNYRIEELDVEKVKKLVEEKAFHTLYAHDQ
LKIQVAAKTVFEGFTEGEITFQPTYKYDTGSDNWDTSEKCRAPAWCDRVLWRGKNISQLS
YQSHMSLKTSDHKPVSSVFEIGVRVVNEELYRKTLEEIVRSLDKMENANIPSVTLSKREF
CFENVKYMQLQTATFTIHNGQVPCEFEFINKPDEETYCKQWLTAKPSRGFLLPDSHVEIE
LELFVNKATATKLNSGKDTIEDILVLHLHRGKDYFLSVTGNYLPSCFGSPIHTLCYMREP
ILDLPLKIVNELTLMTVQTADDRSQLEKPMEIPKELWMMVDYLYRNAVQQEDLFQQPGLR
PEFEHIRDCLDTGMIDHLCANNHSVAEALLLFLESLPEPVICYSAYHSCLECSGSHTASK
QVISTLPTFHKNVFSYLMAFLQELLKNSAKNHLDENILASIFGSLLLRSPAGHRKLDMAE
KKKAQEFIHHFLCNPL
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggaccagtctgtggcaatccaggagaccctggttgagggggaatactgcgtcatcgca
gtacaaggtgtgctgtgtaagggagacagcaggcagagtcgcctgctcgggctggtgcga
taccggctggaaaatgacgtccaggagcatgccctcttcctgtatacacaccggaggatg
gccatcacaggagacgatgtagctctggaccagatagtgccactctccaaagactttatg
ctggaagaagtgtccccagacggtgaactctacatcctcggctctgatgtgacggtacaa
ctgaccacagctgaactcaggcttgtattccaactaccctttggttcacacaccagaaca
ttcctccaggaagttgccagagcctgcccaggtttcgaccctgagacgcgggatcccgag
ttcctgtggctgtgcagacaccggtgcgcggagtccgaagcagagtcgccgaaaccccgc
gagtggaattcggacccgggtacccggagtggcttcgcgcccattggaggaggtggttat
aacgttgacagctcgaggccaaatgggagaggcctgctgcctttggaccaaagctctggg
gccaggtgtccggataaaccagaaaactctctcacaagacagaatagatcgaaggctgaa
attactgacatggttcgctcctccacgatcacggtatcggacaaggctcacattttatcc
atgcagaagttcgggctgcgagacacaatggtgaggtcacacctcctgcagaaggaaggg
gagtatacctacatccagaacttcaggttttttgtgggaacatacaatgtgaacggacag
tcccccaaagaatgcctccggccctggctgagctccgacaccaaggccccagatgtgtac
tgtgtagggttccaggaactcgatctgagtaaggaggccttcttctttcatgatacccca
aaggaggaggagtggtttaaggctgtgtcagaaagccttcacccagatgccaagtacgca
aaggtgaagctcatccggctggttgggattatgttgctgttgtatgtcaaacaggagcac
gcagcctatatctcagaggtggaagctgagactgtggggacaggaatcatgggaaggatg
gggaacaaaggaggagtggccatcaggttccagctgcacaacaccagcatctgcgttgtc
aattcccacctggcagcccacacagaggagtacgagaggaggaaccaggactatagagac
atttgttctcgaatgcagttctctcaggtggacccgagcctcccccctctcaccattagc
aagcacgatgtgatcttgtggctgggggacctcaactacagaatagaagagctggatgtg
gaaaaggtgaaaaagctcgtggaagagaaggccttccacaccctgtatgcgcacgaccag
ctgaaaatccaggtggctgccaagaccgtctttgaaggcttcaccgagggtgagattaca
ttccagcctacttacaagtacgatactggctctgacaactgggataccagtgagaagtgt
cgcgcgcctgcctggtgtgaccgagtcctgtggaggggaaagaacatcagtcagctgagt
taccagagccacatgtccttgaagaccagtgaccacaagcccgtcagctcagtgtttgag
attggggtgagggttgtcaatgaagaactctaccggaagaccctggaggaaatcgtacgc
tccctggataaaatggaaaatgccaacattccttctgtgacactctccaagcgggagttc
tgttttgaaaatgtgaagtacatgcagttgcaaaccgcaaccttcacgattcataatggc
caagtgccctgtgagtttgaattcatcaacaagcctgatgaggagacctactgtaagcag
tggctgacggccaaacccagcaggggcttcctcctgccagattctcatgtcgagattgaa
ctggagctctttgtaaataaggctaccgccacaaaactcaactcaggcaaggacaccatt
gaagacattctggttttacacttgcatcggggaaaggattactttttgtccgtgaccggg
aactacctgcccagctgtttcgggtctcccatccatacattgtgctacatgagagagccc
atcttggatctaccactgaaaattgttaacgagctgaccttgatgacagtgcagactgca
gatgacagaagccagttggagaaacccatggaaatccccaaagaactctggatgatggtc
gattacctatatagaaatgctgtccagcaggaagatctgtttcagcagccaggcctgagg
ccagagtttgagcacataagggactgtttagatactggaatgatcgatcacctctgcgct
aacaaccactctgtagccgaagccttgctgcttttcctagagagcctgccggagcccgtc
atctgctacagcgcctaccacagctgcttggagtgttctggcagtcacacagcgagcaaa
caggtcatttccactctccccaccttccacaaaaatgtcttcagctacttgatggcgttt
ttgcaagaactgctgaaaaattcagcaaaaaatcatttggatgagaatattttagctagc
atatttggcagcttattgctccgaagcccagctggtcaccgaaaacttgacatggcagag
aagaagaaggcccaagagtttattcaccactttctctgcaatccactctga

DBGET integrated database retrieval system