KEGG   Rattus norvegicus (rat): 362591
Entry
362591            CDS       T01003                                 

Gene name
Mtf1
Definition
(RefSeq) metal-regulatory transcription factor 1
  KO
K23317  metal regulatory transcription factor 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362591 (Mtf1)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    362591 (Mtf1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_jaz Marek_A zf-C2H2_6
Other DBs
NCBI-GeneID: 362591
NCBI-ProteinID: NP_001102147
RGD: 1308956
Ensembl: ENSRNOG00000025724
UniProt: D3ZBT4
Position
5q36
AA seq 675 aa
MGEHSPDDNIIFFKGEEDDLTPHDKMLRFVDDNGLVPSSSGTVYDRTTVLIEQDPGTLED
DEDDVQCGEHLPFLVEGEEGFLIDQEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGA
TLTLQSECPETKRKEVKRYQCTFEGCPRTYSTAGNLRTHQKTHRGEYTFVCNQEGCGKAF
LTSYSLRIHVRVHTKEKPFECDVQGCEKAFNTLYRLKAHQRLHTGKTFNCESQGCSKYFT
TLSDLRKHIRTHTGEKPFRCDHDGCGKAFAASHHLKTHVRTHTGERPFFCPSNGCEKTFS
TQYSLKSHMKGHDNKGTAYSALPQHNGSEDTNHSLYLSELGLLSTDSELQENSSSTQDQD
LSTISPAIIFESMFQNPDDPAIQDDPLHTAALIDSFNGDAESVSDVPPPAGNSASLSLPL
VLQPGISEPPQPLLPASTPSAPPPAPSLGPGSQPAAFGSPPALLQPPEVPVPHSTQFAAN
HQEFLPHPQAPPQTIVPGLSVVAGAPASAATVASAVAAPAPPQSTTEPLPAMVQTLPLGA
NSVLTNNPTITITPTPNTAILQSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEQVYF
TTAVPVASSTGSSVQQIGLSVPVIIIKQEEACQCQCACRDSAKERAAGRRKGCSSPPPPE
PNPQPPDGPSLQLPP
NT seq 2028 nt   +upstreamnt  +downstreamnt
atgggggaacacagtccagacgacaacatcatcttctttaagggagaggaagatgaccta
accccgcatgacaagatgctcaggtttgtggatgacaacggactggtgccttcctcatct
ggaactgtttatgataggaccactgttctcatagaacaggaccctggcactttggaggat
gatgaagacgatgtacagtgtggagaacacttgccttttctggtggaaggtgaagagggc
ttcctaatagatcaggaagcaatgtcccagggttacgtacaacacattatctcaccagat
cagattcatttgactataaaccctggttccacgcccatgccaagaaacattgaaggtgcg
actcttactctgcagtcggaatgtcctgaaacgaaacggaaagaagtaaagcggtaccag
tgcacctttgagggatgcccgcgcacctacagcacagcaggcaacctacgcacccaccag
aagactcaccgaggagagtacacctttgtctgtaatcaggagggctgtggcaaggccttc
ctcacctcctacagcctcaggatccatgtgcgagtgcacacaaaggagaagccatttgag
tgtgacgtgcagggctgtgagaaggcattcaacacactgtacaggttgaaagcacatcag
aggcttcacacagggaaaacgtttaactgtgaatctcaaggctgcagcaagtacttcacc
acactcagtgatctgcggaagcacattcgaacccatacaggagaaaagccatttcgatgt
gatcatgacggctgtggaaaagcatttgcagcaagccaccaccttaaaactcacgtccgt
acacacactggcgaaagacccttcttctgccccagtaacggctgtgagaagacatttagc
actcagtacagtctcaaaagtcacatgaaaggtcacgataacaaaggcaccgcgtacagt
gcacttcctcaacacaatggatcagaggatacaaatcactcactttatctgagtgagttg
ggccttctgtccacggattctgaattgcaagaaaattccagttcgacacaggaccaggac
ctcagcacaatttcaccagcaatcatctttgaatcaatgttccagaatcctgacgaccct
gcgattcaggatgaccctctgcacacagctgccttgattgacagcttcaacggagatgca
gaatctgtcagtgatgtcccaccgcctgcaggaaattcagcgtctttatctcttccactt
gtactgcagcctggcatctccgagccaccccagcctctgctgccagcctcaactccgtcc
gctcctccacctgctccctccctaggacctggttcccagccagctgcatttggcagcccc
cctgctctcttacaacctccagaagtgcctgttccccacagcacacagtttgctgctaat
catcaagagtttcttccgcacccccaggcgccaccccagaccatcgtaccaggactctct
gttgttgctggggctcctgcatcagcagcaacagtggcatcagccgtggcagcaccagcc
ccaccacaaagtactactgagcccctgcctgctatggtccagactctgcccctgggtgcc
aactctgtcctaactaataatcccaccataaccatcaccccaactcctaacacggcaatc
ctgcagtccagcctagtcatgggagagcagaacttacagtggatattgaacggtgccacc
agttcaccacaaaaccaagaacaaattcagcaagcatcgaaagtggagcaggtgtacttt
accaccgcagtaccagtagccagtagcacagggagctctgttcagcagattggcctcagt
gttcctgtgatcatcatcaaacaagaggaggcctgtcagtgtcagtgtgcgtgccgggac
tctgcgaaggagcgggcggccggccggagaaagggatgttcttccccaccccctccagag
ccgaacccccagcctcctgatgggcccagcctgcaactgccaccctag

DBGET integrated database retrieval system