KEGG   Rattus norvegicus (rat): 362612
Entry
362612            CDS       T01003                                 

Gene name
Srsf4, RGD1561347, Sfrs4
Definition
(RefSeq) serine and arginine rich splicing factor 4
  KO
K12893  splicing factor, arginine/serine-rich 4/5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    362612 (Srsf4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    362612 (Srsf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    362612 (Srsf4)
Spliceosome [BR:rno03041]
 Common components
  Common spliceosomal components
   SR proteins
    362612 (Srsf4)
SSDB
Motif
Pfam: RRM_1 RRM_3 Nup35_RRM_2
Other DBs
NCBI-GeneID: 362612
NCBI-ProteinID: NP_001102155
RGD: 1561347
Ensembl: ENSRNOG00000010007
UniProt: G3V798 B1H240
Position
5q36
AA seq 488 aa
MPRVYIGRLSYQARERDVERFFKGYGKILEVDLKNGYGFVEFDDLRDADDAVYELNGKDL
CGERVIVEHARGPRRDGSYGSGRSGYGYRRSGRDKYGPPTRTEYRLIVENLSSRCSWQDL
KDYMRQAGEVTYADAHKGRKNEGVIEFVSYSDMKRALEKLDGTEVNGRKIRLVEDKPGSR
RRRSYSRSRSHSRSRSRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSHSRSKSRSRSQSRS
RSKKEKSRSPSKDNKSRSRSRSPDKSRSKSKDHAEDKLQNNDSAGKAKSHSPSRHDSKSR
SRSQERRAEEERRSSTSRGHSQEKSLLKSRSRSRSKVGSRSRSRSKSKDKRKGRKRSREE
SRSRSRSKSERSRKHSSKRDSKVSSSSSKKKKGDTDHSRSPSRSVSKEREHATAEPGQRE
SRAEGESEGPNPEPRARSRSTSKSKPSLPAESRSRSKSASKTRSRSKSPSRSASRSPSRS
RSRSHSRS
NT seq 1467 nt   +upstreamnt  +downstreamnt
atgccgcgcgtgtacatcggccgcctgagctaccaggcccgggagcgcgatgtggagcgc
ttctttaagggctacgggaagatcctggaggtggatctgaagaacgggtatggttttgtg
gagtttgatgatctgcgtgatgcagatgatgctgtttatgaactgaatggcaaagacctc
tgtggtgaacgagtcattgttgagcatgcccgaggcccacgtcgggacggcagttacggt
tctggacgcagtggatatggttatcgaagaagtggccgagataaatatggtcctcctact
cgcacagagtacagacttattgtggagaatctgtcaagtcgatgcagctggcaagatcta
aaggattatatgcgtcaggcaggagaagtgacgtatgcagatgctcacaagggacgcaaa
aacgaaggagtgattgaatttgtgtcttactctgatatgaaaagagctttggaaaagttg
gatggaactgaagtcaacggcagaaaaatcagattagttgaagacaagccaggttctaga
cggcgccggtcttactccagaagccggagtcactcaaggtctcgctctcgaagcagacat
tctcggaagagcagaagccgaagtggtagcagtaaaagcagccattcaaagagccgctct
cgatccaggtcgggttcccactcccgcagcaagagccgcagccgcagccagagccgcagt
cgcagtaagaaggagaaaagccggagccccagcaaagacaacaagagccgcagtcgcagc
cgcagccccgacaagagccgaagcaaaagtaaagaccatgcagaggacaagctccagaac
aacgacagcgctggcaaagccaagagccacagccccagccgccatgacagtaaaagtcgg
agcaggagccaggagaggagagcagaggaggagaggagaagcagcacgagcaggggtcac
agccaggagaagagcctgcttaagagccgcagccgcagccgcagcaaagtgggcagccgc
agccgcagccgcagcaaaagcaaggacaagcggaagggccggaagagaagcagggaagaa
agtcgaagccggagccgcagcaagagcgagcgcagccggaagcatagcagcaagcgggac
agcaaagtcagcagcagcagcagcaagaagaagaagggagacaccgaccactcccggtca
ccgtcccgctcagtgtcaaaggagcgggaacatgccacggcagagcctggccagagggaa
agccgggctgagggtgagagcgagggtcccaatccagagccccgggccaggtcaagatcc
acttccaaatccaaacctagtctcccggcagagtcccgctccaggtcaaagtcagcttca
aaaacgcgctctcggtccaagtctccatccaggtctgcttccaggtcgccctcccggtct
agatccaggtcccactcaaggtcctaa

DBGET integrated database retrieval system