KEGG   Rattus norvegicus (rat): 362628
Entry
362628            CDS       T01003                                 

Gene name
Ifnlr1, Il28ra, RGD1562689
Definition
(RefSeq) interferon, lambda receptor 1
  KO
K05140  interferon lambda receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    362628 (Ifnlr1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362628 (Ifnlr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    362628 (Ifnlr1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL10/28 receptor family
   362628 (Ifnlr1)
SSDB
Motif
Pfam: Tissue_fac CAF1A
Other DBs
NCBI-GeneID: 362628
NCBI-ProteinID: NP_001178797
RGD: 1562689
Ensembl: ENSRNOG00000033984
UniProt: D3ZB58
Position
5q36
AA seq 530 aa
MWRAGRWAPLLLFLMQSALGRPRLAPPRNVTLLSQNFTVYLTWLPGLGSPPNVTYFVTYK
SYNNHWRRVEHCAGISTLVCPMMCLKKQDLYIKFKGRVQAASAHVKSPWVESRYLEYIFD
VELAPPTLVLSQKEKILNVNATYQLPPCMPRSLELKYQVEFWKEDLRSKTLFPDTPYGQP
VKIPLQQDARGRHCFSARTVYTLTHTKYSLFSEPSCIFLAAPGANRAVLAVPLLLLLLIA
AAAAGTAWKKMDGNPWFQWVKMPQALDFSENRHPVATFQPSGPEFSGDLILCPQKELTIR
TRPVPRVRGPATLQAGSEKDSTEDEDEDTDDDGDSIQPYLERPLFVREKLQVTEHSEADE
SGVDSVGSEGSSAWDSSGGSWSSTGVSSGDSSYKDEAGSSSCLDQKKPDQEPHGDGHQGP
LPCLEFSEDLGTVEELLKDDLSGWRIWGTLSPKRDLAPVEPPVSLQTLTFCWDSNPEEEE
EEEEEEEEEEEEEEEDWESDLKDSNTSCWDASSPQRTDVRGGMLGDYMVR
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgtggcgggctggccggtgggcgcccctactcctgttcctgatgcaaagcgccctagga
aggccccgtctagccccacccagaaacgtgacactgctctcccagaatttcactgtttac
ctgacatggctcccagggctaggtagccccccgaatgtgacctactttgtgacctacaaa
agctataacaatcattggcgaagagtagagcattgtgcgggcatcagtactctggtgtgt
cccatgatgtgcctgaagaaacaggacctgtacatcaagttcaaaggtcgagtacaggca
gcttctgcccatgtgaagtccccatgggtggagtccaggtacctggaatacatttttgat
gtggagctagccccacccaccctggtgctctcccagaaggagaagatcctaaatgtcaac
gctacctaccagctgccaccctgcatgcctcggtcactggaactgaagtaccaggtggag
ttctggaaggaggacctgagaagcaagaccctgtttccagacactccatatggccagcca
gtgaagattcctctccagcaagatgctcgtggacgccactgcttcagcgccagaaccgtc
tataccttaacccacacgaagtacagcctgttctctgagcccagctgcatcttcctagcg
gccccaggggccaacagggctgtcctggcggtgcccttactcttgcttctactgatagca
gcggctgcagcgggtacggcatggaagaaaatggatgggaacccctggtttcagtgggtg
aagatgccccaggcactggacttttctgaaaacagacacccagtggcgacctttcagccc
agtggacctgagttctcaggtgacttgatcctctgtccccagaaggaactgaccataagg
accagaccagtccctcgggtcagaggcccagccacactgcaggcaggatcagaaaaagac
agtactgaggatgaagacgaggacacagacgacgacggtgacagcatccagccctacctg
gaacggcccctcttcgtgagggagaagctccaggttacggagcactcagaggcagatgaa
tctggggtggattcagttgggagcgaaggctcgtctgcatgggactcttcaggtgggagc
tggtccagcacaggggtctcctcaggggactcctcttataaagatgaagctggatcttcc
agctgtttggaccagaagaagccagaccaggagcctcatggggatgggcaccaggggcct
ctcccatgcctggaattttctgaggacttgggcactgtggaagagcttctgaaagatgac
ctctccggttggagaatatggggtaccttatccccaaagagagatctggctcctgtggag
cccccagtttctcttcagacactgactttctgctgggacagcaatccagaggaagaggaa
gaggaagaggaggaggaggaggaagaggaagaggaagaggaagaagactgggaatcagac
cttaaggacagcaacaccagctgttgggatgcttcaagcccgcagaggacagacgtcagg
ggtgggatgctgggagattacatggtcaggtga

DBGET integrated database retrieval system