KEGG   Rattus norvegicus (rat): 362629Help
Entry
362629            CDS       T01003                                 

Gene name
Il22ra1, RGD1559655
Definition
(RefSeq) interleukin 22 receptor subunit alpha 1
  KO
K05138  interleukin 22 receptor alpha 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    362629 (Il22ra1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    362629 (Il22ra1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    362629 (Il22ra1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:rno04050]
    362629 (Il22ra1)
Cytokine receptors [BR:rno04050]
 Interleukin receptor families
  IL10/28 receptor family
   362629 (Il22ra1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tissue_fac Interfer-bind
Motif
Other DBs
NCBI-GeneID: 362629
NCBI-ProteinID: NP_001178798
RGD: 1559655
Ensembl: ENSRNOG00000027976
UniProt: D3ZIM3
Position
5q36
AA seq 577 aa AA seqDB search
MKTLLTILTVGSLAAHTTEDTSGLLRHVKFQSSNFENILTWDAGPASAPDTVYSVEYKKY
GEKEWLAKAGCQRITQKFCNLTVETRNHTEFYYAKVTAVSSGGPPVTKMTDRFSSLQHTT
IRPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLKLHVNHTYQMNLE
GKQREYEFLGLTPDTEFLGSITILTPILSKESAPYTCRVKTLPDRTWAYSFSGAVLFSMG
FLVGLLCYLGYRYITKPPVPPNSLNVQRVLSFQPLRFIQEHVLIPVLDLSGPSSLPQPIQ
YSQVVVSGPREPPGAGRRRHSLSDLTYVGQSDGSILQPTNGPAQQTLSPPSYAPKALPEV
QPLSYAPQVASDAKALLYSPQQGIKTGPATYDPQDVLDSWPASYAVCVEDSGKDSTPGIL
SSPKHLKLQEDTLVRSCLPGDLSLQEVTSLGEEEAQRPKSLPPPLGFCTNGPDLHTLHSE
EPETPRYLKGGLSLLSSVQIEGHPVSLPLHLHSVSCSPSDQGPSPWGLLDSLVCPKDEGP
VAETEAILPSAVASELEQSTELDSLFKGLALTVQWES
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgaagacactactgaccatcctgactgtgggatccctggctgctcacaccactgaggac
acatctggtctccttcgacacgtgaaattccagtccagcaactttgaaaacatcttgacg
tgggatgctgggccagctagcgcccctgacacggtctacagtgtggaatataagaagtac
ggagagaaagagtggctggccaaggctggctgccagcggatcacccagaagttctgcaac
ctgactgtggagacccgaaaccataccgaattttactacgccaaggtcacggcagtcagc
tcgggaggcccaccggtcactaagatgactgatcgcttcagctcgctgcagcacactacc
atcagaccacccgatgtgacctgtatccccaaagtgaggtccattcagatgctggtccac
cccacgctcacacccgtcctctcggaagatggccaccagctaaccctggaggagattttc
catgacctgttctaccgcttaaaactgcacgtcaaccacacctaccaaatgaaccttgaa
ggcaaacagagagagtatgagttccttggcctgacgcccgacacagagttcctcggctcc
atcacaattttgactccaatactgtccaaggagagcgccccctacacgtgccgagtgaag
acgctgcccgatcggacgtgggcctactccttctcgggtgcagtgctgttctccatgggt
tttctcgtcggcttgctctgttatctgggctacagatacattaccaagccacctgtacct
cctaactccctgaatgtccagcgtgtcctgagctttcagcccctacgtttcatccaggaa
cacgtgctgatccctgtcttggacctcagtggccccagcagtctacctcagcccatccag
tactcccaagtggtggtgtctgggcccagggagccacctggagctgggcggcggcggcac
agcctgtctgacctcacctatgtagggcagtcagacggctccatcctccagcctaccaat
gggccagctcagcagacactgtccccaccatcctacgctccaaaggctctccctgaggtg
cagcccctttcctatgcacctcaggtagcctcagatgccaaagctctgctctactcacca
caacaggggataaagactgggcctgccacctacgacccgcaagacgttctggacagctgg
cctgcttcctatgctgtgtgtgtggaagactctggcaaagactccaccccggggatcctc
tccagtcccaaacacctcaagctccaggaagacacacttgttagaagctgtctcccaggg
gacctttctctgcaggaagtcacctccttgggtgaggaggaggcacagagaccaaaatca
cttcctccacctctggggttctgcacaaacggacctgaccttcacacattgcacagtgag
gaaccagagacacctcggtacctgaagggggggctgtccctcctgtcctctgtgcagatc
gagggccaccctgtctccctccctttgcacctccattctgtctcatgttccccctcagac
cagggaccaagcccctggggcctgctggactcccttgtgtgtccaaaggatgagggtcca
gtggctgagactgaggccatactccccagtgctgtggcctctgagctggagcagtccaca
gaactggactcacttttcaaaggcttggccctaactgtgcaatgggaatcctga

DBGET integrated database retrieval system