KEGG   Rattus norvegicus (rat): 362636
Entry
362636            CDS       T01003                                 

Gene name
Usp48
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 48
  KO
K11858  ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    362636 (Usp48)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    362636 (Usp48)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     362636 (Usp48)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C19: ubiquitin-specific protease family
   362636 (Usp48)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    362636 (Usp48)
SSDB
Motif
Pfam: UCH UCH_1 DUSP ubiquitin
Other DBs
NCBI-GeneID: 362636
NCBI-ProteinID: NP_942080
RGD: 735213
Ensembl: ENSRNOG00000013602
UniProt: Q76LT8
Position
5
AA seq 1036 aa
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCRGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYTKGDGIRGGKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNVVQQQFCGEYAYVTVCSQCGRESKLVSKFYELE
LNIQGHKQLTDCISEFLKEERLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNAYIGFSESLDMEPYVEHKGGSFVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGDWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKNHTMVQVPAFLQELVDRDNSKFEEWCVEMAEMRRQSVDKGRAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNNACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKDCVVERCRILRLKNQLNEDYKTVNNLLKATMKGSDGFWVGKSSLR
SWRQLALEQLDEQDGEAEQSNGKINGSPFSKDESKEEKKEEEEELNFNEDILCPHGELSI
SENERRLVSQEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTS
LPNLFQDKNRPCLSNWPEDTDALYIVSHFFLDEWRKFVRKPARSTPVSSVGNAALLCPHG
GLMFTFPSLTKEDSKLIALIWPSEWQMIQKLFVVDKVIKITRIEVGDVNPSQTQYISEPN
LCPDCREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKP
DGEKDPDFNQSNGGTKRQKTSQQGYVAYQKQVIRRSTRHRKVRGEKALLVSANQTLKELK
IQIMHAFSVAPFDQNLSIDGKILNDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQ
VCMPEEGFKGTGLLGH
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggctccgcggctgcagctagagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcatatcgagaccgcctaccgcatctggctggagccctgtatc
cgaggcgtgtgcagaagaaactgcagaggaaatccgaattgcttagttgggattggcgag
cacatttggttaggagaaatagatgagaatagttttcataacattgatgaccccaactgt
gagaggaggaaaaagaattcgtttgtgggcctgactaatctgggagccacctgttacgtc
aacaccttcctccaggtgtggttcctcaacttggagcttcggcaggcgctatacttatgc
ccaagcacctgtagtgattacacgaagggagatggtatccgtggaggaaaagattatgag
cctcagacaatttgtgagcatcttcagtacttgtttgctttgttgcaaaacagtaacaga
cgatacatcgatccttcaggatttgttaaagccttgggcttggacactggccagcagcag
gatgcacaagagttttccaagctctttatgtcgctgttggaagacactttgtctaaacag
aagaacccggatgttcggaacgtcgtgcagcagcagttctgtggggagtacgcctatgtg
acagtgtgcagtcagtgtggccgagagtctaagctcgtatcgaagttctatgaactggag
ttaaacatccaaggccacaagcagttaacagactgcatctccgagttcctgaaggaagaa
aggttagaaggagacaatcgatacttctgtgaaaactgtcaaagcaaacagaatgccacg
cggaaaatccgacttctgagcctcccttgcactctgaacttgcagctgatgcgttttgtg
tttgaccggcaaactggacacaagaagaaacttaatgcttatattggcttctcggagagc
ctagatatggagccatatgtggagcacaaaggcgggtcctttgtgtacgagctcagcgcg
gtcctcatccacagaggagtcagtgcctattccggccactacatcgcccacgtgaaagac
ccccagtctggagactggtacaagttcaatgatgaggacatagagaagatggaggggaag
aaactacagctagggattgaggaagatctagcagaaccttctaagtcccagacccgaaaa
cccaagtgtggcaaaggaactcactgctctcgaaatgcatacatgttggtttatagactg
caaacccaggaaaagaaccacacgatggttcaagtcccagcctttctccaagagctggtg
gatcgggataattccaaatttgaagagtggtgtgtagaaatggccgagatgcgcaggcag
agtgtggacaagggcagagcgaagcacgaggaggtgaaggagctgtaccaaaggttgcct
gctggagctgagccctatgagtttgtctctcttgagtggctgcagaagtggctggatgaa
tcaacccctaccaaacctattgataataatgcctgcctgtgttcccatgacaagctccat
ccagacaaaatatcaattatgaagagaatatcggaatacgcagctgacattttctatagt
cgatatggaggaggtcccagactcactgtgaaagccctctgtaaggactgtgttgtggag
cgctgtcgcatactgcgcctgaagaatcaactaaatgaagattacaaaactgtcaacaat
ttgctgaaagcaacaatgaagggcagtgatggattttgggtaggaaagtcttccttgcgc
agctggcgccagctggctcttgagcaactagatgagcaagacggtgaggcggagcaaagc
aatggaaagataaatgggagtcccttcagtaaagatgaatcaaaggaagaaaagaaggaa
gaggaggaggaactaaattttaatgaagacattctgtgtcctcatggagagttaagcata
tctgaaaatgaaagaaggctcgtttctcaggaggcttggagcaaactgcagcagtatttc
ccaaaggctcctgagttcccaagttacaaagagtgctgctcgcaatgcaagatactagaa
cgagaaggtgaagaaaatgaagccttgcataaaatgattgcaaatgagcaaaagacctca
cttccaaacttgttccaggacaaaaacagaccgtgcctcagtaactggccagaggacacg
gacgctctctatattgtgtcgcacttctttttagatgaatggcggaaattcgttaggaag
cctgcgaggtccactcccgtgtcctcagttgggaacgctgcccttctctgtccacatgga
ggactcatgtttacatttccttccctcaccaaagaagactcgaaacttatagctctcata
tggcccagcgaatggcaaatgattcaaaagctctttgttgtggataaagtaattaaaatc
acaagaattgaagtgggagacgtaaacccttctcaaacacagtatatttctgagcctaat
ctctgtccagattgcagagaaggtctgctgtgccagcagcagagggaccttcgagagtat
acccaagccaccatctatgtccacaaagttgtggacaacaaaaaggtgatgaaggactca
gctccagagttgaatgtgagtagttctgagacggaggaggacaaggaggaagctaagcca
gacggagagaaagaccctgactttaatcaaagcaatggaggtaccaagcgacagaaaaca
tcccaacagggctatgtggcctaccagaagcaagtcatccggaggagcacgcggcaccgg
aaggttcggggagagaaagcactgctggtgtctgccaaccagacgttaaaagaactgaag
attcagatcatgcatgcattctcagttgctccgtttgaccagaatttgtcaattgatgga
aagattttaaatgatgactgtgctacccttggtaccctcggtgtcattcctgagtctgtc
attttattaaaggcagatgagccaatcgcagactacgctgcaatggatgatgtcatgcaa
gtttgtatgccggaagagggctttaaaggtacaggcctgcttggacattaa

DBGET integrated database retrieval system