KEGG   Rattus norvegicus (rat): 362638
Entry
362638            CDS       T01003                                 

Gene name
Cda
Definition
(RefSeq) cytidine deaminase
  KO
K01489  cytidine deaminase [EC:3.5.4.5]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno00983  Drug metabolism - other enzymes
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    362638 (Cda)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    362638 (Cda)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.5  cytidine deaminase
     362638 (Cda)
SSDB
Motif
Pfam: dCMP_cyt_deam_1 dCMP_cyt_deam_2
Other DBs
NCBI-GeneID: 362638
NCBI-ProteinID: NP_001102158
RGD: 1311101
Ensembl: ENSRNOG00000015677
UniProt: D4AC20
Position
5q36
AA seq 146 aa
MAQERPSCAVEPEHVQRLLLSSREAKKSAYCPYSRFPVGAALLTGDGRIFSGCNVENACY
PLGVCAERTAIQKAISEGYKDFRAIAIASDLQEEFISPCGACRQVMREFGTNWAVYMTKP
DGTFVVRTVQELLPASFGPEDLQKIH
NT seq 441 nt   +upstreamnt  +downstreamnt
atggcccaggaacgcccctcctgtgccgtggagcctgagcacgtccagcggctgctgctg
tcctctcgtgaagccaagaagtcagcctactgcccctacagccgcttccctgttggggct
gccctgctcaccggggacgggaggatcttctctgggtgcaacgtagaaaacgcctgctac
ccacttggtgtgtgtgccgagcggaccgccatccagaaggccatctctgaaggctacaag
gatttcagggctattgccattgccagtgacttgcaagaagagttcatctctccctgcgga
gcctgccgacaagtcatgagagagtttggcaccaactgggctgtgtacatgaccaagccc
gatggcacattcgtagtgaggacggtccaggagctgctgccggcctcgtttgggcctgaa
gacttgcagaagattcactga

DBGET integrated database retrieval system