KEGG   Rattus norvegicus (rat): 362645Help
Entry
362645            CDS       T01003                                 

Gene name
Atp13a2, RGD1307977
Definition
(RefSeq) ATPase 13A2
  KO
K13526  cation-transporting P-type ATPase 13A2 [EC:7.2.2.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    362645 (Atp13a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase P5-ATPase Hydrolase Cation_ATPase Cation_ATPase_N
Motif
Other DBs
NCBI-GeneID: 362645
NCBI-ProteinID: NP_001166903
RGD: 1307977
Ensembl: ENSRNOG00000008052
UniProt: B5DEH6
Position
5q36
AA seq 1145 aa AA seqDB search
MSADSSPLLGSTPPSYGTLMTGTSIDPLSSSVSSVRLSGYCGSPWRAIGYHAAVWMLAGI
PWLLFRWKPLWGVRLRLRPCSLARAETLVIEIRDKEGSSRQLFTVQVQTEAVVDGSLELP
SQAKAEDGRSLAAVGVAPESMWQDTTQLHRQKEAKQVLRYYILQGQRYVWMETQQAFCQV
SLLDHGRACDDIHCSSSGLSLQDQAVRKTIYGPNVIGIPVKSYLQLLVDEALNPYYGFQA
FSIALWLADHYYWYAVCIFLISAISICLSLYKTRKQSMTLRDMVKLSVRVQVCRPGGEEE
WVDSSELVPGDCLVLPQEGGMMPCDAALVAGECVVNESSLTGESIPVLKTALPEGPQPYC
PETHRRHTLFCGTLVLQARAYLGPRVLAVVTRTGFCTAKGGLVSSILHPRPISFKFYRHS
MKFVAALSVLALLGTIYSIIILYRNRVPVKEIVIRALDLVTVVVPPALPAAMTVCTLYSQ
SRLRTQGIFCIHPLRINLGGKLRLVCFDKTGTLTEDGLDIMGVVPLKGQMLLPLVPEPCH
LPPGPLLRALVTCHALSQLHDTLVGDPMDLKMVESTGWVLEEGSAAGSAPGTQVLVVMRP
PPRGPQQQEESPEPVSVLRRFPFSSALQRMDVVVTWPGATQPEAYVKGSPELVASLCSPE
TVPRDFPQVLQSYTAAGYRVVALAGKPLPTAPSLEAAQQLTRDTVEQELSLLGLLVMRNL
LKPQTTPVIQTLRKTGIRTVMVTGDNLQTAVTVAKACGMVGTQEHLAIIHATHPEQGQPA
ALEFLPTEPSAAMNGAKDPVQATDYPVEPESQSRHLALSGSTFAVLQKHFPKLLPKVLVQ
ATVFARMAPEQKTQLVCELQRLQYCVGMCGDGANDCGALKAADVGISLSQAEASVVSPFT
SSMASIECVPTVIREGRCSLDTSFSVFKYMALYSLTQFISVLILYTINTNLGDLQFLAID
LFITTTVAVLMSRTGPALTLVRARPPGALLSVPVLGSLLLQVALVAGIQLGGYFLVIAQP
WFVPLNRTVPAPDNLPNYENTVIFSLSGFQYLILAAAVSKGAPFRQPLYTNGLRNIADSS
FKLLLLGLVAFNFVGAFMLESVLDQCLPACLQWLRPKRASKKQFKQLQRELAERPWPTLP
VGSMR
NT seq 3438 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcagacagcagcccgctcctgggcagcacgccccccagctatgggaccctgatg
acagggacatcaatcgatcccctcagctcctcagtttcatccgtgaggctcagcggctac
tgtggcagtccatggagggccatcggctatcacgccgcggtctggatgctggccgggatc
ccttggctgctattccgctggaagcccttgtggggcgtgcgcctgcgcctgaggccatgc
agcctggcccgcgccgaaacactcgttatagaaataagagacaaagagggtagctccaga
cagctcttcactgtccaggtgcagactgaggctgttgtcgacggcagcctggagctgccc
tcacaggccaaggcagaggatggccggagcctggcggccgtgggagtggcaccggagagc
atgtggcaggacactacgcagctccacaggcagaaagaggcaaagcaggtactgcgctat
tacatcctccagggccaacgctatgtctggatggagacccagcaagccttctgccaagtc
agcctgctggaccacggtcgtgcctgcgatgacatccattgctccagttctggcctcagc
ctccaggaccaggctgtgaggaagaccatttacggccccaacgtgattggtattcccgtc
aagtcctacctgcagctactggtggatgaggcactgaacccctactacggattccaggcc
ttcagcatcgccctgtggctggctgaccactactactggtatgctgtctgcatcttcctc
atctcggccatctccatctgcctgtctctctacaagaccaggaagcaaagcatgactctg
agggacatggtcaagttgtccgtgcgggtgcaggtgtgccgacccggaggagaggaagag
tgggtggactccagtgagctggtgcccggagactgcctggtgctgccccaggagggcgga
atgatgccgtgtgatgctgctctggtggccggggagtgtgtggtcaatgagagctccctg
acaggagaaagcatcccagtgttgaagacagccctgccagaggggccccagccctactgc
ccagagacccaccggcggcacactctcttctgtggcaccctcgttctgcaggcccgggcc
tacctgggaccccgtgtcctagccgtggtaactcggacagggttctgcacagccaaaggg
ggcctggtgagctccatcctacacccacggcccatcagcttcaagttctacagacacagc
atgaagtttgtggcagcgctgtccgtcctggctctgctcggtaccatctacagcatcatc
attctctaccgaaaccgggtgcccgtgaaggagatcgtgatccgagctctggacctggtg
acggtggtggtaccacccgccctgccggccgccatgaccgtgtgcacactctactcccag
agccggctgcgtacacagggcatcttctgtatccacccgctgcgcatcaacttggggggc
aagctgcgcctcgtgtgcttcgacaagacaggcaccctcacggaggacggattggacata
atgggggtggtgcccctaaaggggcagatgttgctgccactggtcccagagccctgccac
ctgcccccagggcccctcctccgagcactggtcacctgtcatgccctcagccagctacat
gataccttggtgggcgaccccatggatctcaagatggtggagtctacaggctgggtctta
gaggagggttcggctgcaggctcagcacctgggacccaggtcttggtggtaatgcgaccc
ccacccagggggcctcagcaacaggaagagtcaccagagccagtcagtgtcctccgccgc
ttccccttctcctctgccctgcagcggatggacgtggtggtgacatggccaggggccacc
cagcctgaggcctacgtcaaaggctccccagagcttgtggccagcctctgcagccccgag
acagtgcccagagactttcctcaggtactgcagagctacacagctgctggctaccgagtt
gtggccctggctggcaagccactgcccactgcgcccagccttgaggccgctcagcagctg
acaagggacactgtggagcaggagctgagcctcctggggctgctggtcatgcggaacctg
ctgaagccacagacgaccccagttatacagaccctgaggaagacgggcatccgtactgtt
atggtgacaggggacaacctgcagacagcagtcacggtggccaaagcgtgtggcatggtg
ggcacccaggagcacctggctatcatccatgccacccaccctgagcagggccagcctgct
gcccttgagttcctgccaactgagccctctgcggccatgaatggggcaaaggatcctgtg
caggccacggactaccccgtggagccggagtcccagtcccgtcacctggccctcagtggg
tccacgtttgctgtccttcagaagcacttccccaagctgctgcccaaggtcctggtgcag
gccaccgtctttgcccgcatggccccggagcagaagacacagctagtgtgtgaacttcag
agacttcagtactgcgtgggcatgtgcggggatggagccaatgactgtggggccctgaag
gcggctgacgtgggcatctcactgtcccaggcagaggcctcagtggtctctccgttcacc
tccagcatggccagtattgaatgtgtgcccactgtcatcagggaaggccgctgctctctg
gacacttcattcagcgtcttcaagtatatggccctatacagcctgacccagttcatctct
gtcctcattctctacacaatcaacaccaacctgggagacctacagttcttggccatcgac
ctgttcatcaccaccacggttgccgtgctcatgagccgcaccggccctgcactgaccttg
gtgcgagcacggccaccaggggcgctgctgagcgtgcctgtacttggcagtttgctgctg
caggtggccttggtggccggcatccagcttgggggctactttttggtcatagctcagccc
tggtttgtgcctctgaacagaactgtacccgcacctgacaacctgcccaactacgagaac
acagtgatcttctctctgtctggcttccagtacctcatcctggccgcagcggtgtctaag
ggggcacccttccgccagccgctctacaccaacggactgaggaacattgcggacagctct
ttcaagttgctgctgctgggtctggtcgccttcaactttgtgggcgccttcatgctggag
agcgtgctggaccagtgtctcccagcctgcctgcagtggctgcggcctaaacgggcctcc
aagaagcaattcaagcagctacaacgggagcttgctgaacgtccatggcccactctgccc
gttggctccatgaggtag

DBGET integrated database retrieval system