KEGG   Rattus norvegicus (rat): 362701Help
Entry
362701            CDS       T01003                                 

Gene name
Capn13, CANP_13
Definition
(RefSeq) calpain 13
  KO
K08581  calpain-13 [EC:3.4.22.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    362701 (Capn13)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     362701 (Capn13)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C2: calpain family
   362701 (Capn13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_7 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 362701
NCBI-ProteinID: NP_001020304
RGD: 1562682
Ensembl: ENSRNOG00000032375
UniProt: Q5BK10
Position
6q13
AA seq 668 aa AA seqDB search
MAHDTEALEETSVVKFKNQDFRFLRDRCLSRGQLFIDDTFPAEASSIGQKLLMGKRLPKL
EWKRPQDLSFGPPHFILEGASRFDIQQGRAGDCWFLAALGSLTQNPQCLQKILMNQSFSY
QYAGIFHFRFWQCGQWVEVVIDDRLPVVGNNFCFVHPRRGNQEFWPCLMEKAYAKLLGSY
SQLHYGYLPDALVDLTGGVVTRINLHSSPSDLLMVVKTAVQTGSMVACATPKWLTEESEV
MENGLVSQHAYTVTGAEKIQYRRGWEEIIRLWNPWGNTEWRGRWGDGSQEWWETHGSRKS
QLYENKDDGEFWMSCRDFHENFSCLYICSQFPITMDPGVTPNESWRQMRFKNQVISGNTA
GGDGRDIQYLFDVQEPMDGNNVIVAFTVMPQSLKTEEWPFPLQFQVFKVDSQFQKFQKRL
PPAFFSQFRDAAQGIDYVTKRNFTKSFHLSPGTYVVVASAHGKEVEFLLRIFLKMPHKDR
NPNSSFNLKALKGSLSENESPKSSFHRYMDQGLDIDASQLQSLLNQEYLTGPPGDTFSLD
QCQSIMALMDLKVNGRLDREEFARLQSRLIHCQHVFQHIQRSQGVLRSSDLWEVIESTDF
LSGVLLSKELLSLMTLRYSDSSGRLSFPSLVCFLIRLETMSKAFRNLSKDGKSIYLTEME
WMKLVMYS
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggcacatgacacagaggctctagaagaaacctccgtggtcaagttcaagaaccaggac
tttagattcttacgggatcgttgcctgagcaggggtcagctgtttatagatgatacattc
cctgctgaggcatcttccattggccagaaactgctcatgggaaagcgccttccaaaattg
gagtggaagcgaccacaggatttatccttcggcccccctcacttcattctggaaggtgca
agcagatttgacatccaacaaggaagagcgggagactgctggttcctggcagcactgggt
tctctgacccagaacccgcagtgtctgcagaagatcctgatgaaccaaagcttttcgtac
cagtacgctgggattttccacttccggttctggcagtgtggtcagtgggtggaagtagtc
atcgatgaccgcttgcctgtcgtaggcaacaacttctgctttgtgcatcctcgcagaggc
aaccaagaattctggccctgcctgatggagaaagcctatgccaagctgctaggctcatat
tcccaattacactatggctaccttcctgatgcgctggtggacctcacaggaggagtggtc
accaggatcaacctgcactcctctccctctgacctattgatggtagtgaagaccgcagtc
cagacaggctcaatggtggcctgtgccaccccaaagtggctgacagaagagtccgaggtt
atggagaatgggctggtgagccagcatgcatacacagtgactggagctgagaagattcag
taccggaggggctgggaagaaatcatccgcctttggaacccctggggcaacacagaatgg
agaggccgctggggagatgggtcccaggagtggtgggaaacccatggctcacggaaaagc
cagctgtacgagaataaggatgacggcgagttttggatgtcctgtcgagatttccatgag
aacttctcgtgcctgtacatatgtagccagttcccgatcactatggatcctggagtcaca
cccaatgagagctggcgacaaatgaggtttaagaaccaagtgatctcaggaaacacagca
ggaggagatggaagggatatacagtacctctttgacgttcaagagcccatggatggtaac
aatgtcattgtggctttcacagtcatgccacaaagcctgaagacagaagagtggccattt
ccactacagttccaggtgttcaaggtggattcccagttccagaagttccagaaaagactg
ccacctgcatttttctcccaattcagagatgctgcccagggaatagactatgtaaccaaa
cgcaacttcacaaagtccttccacctgagtcctgggacctatgtagtggttgcctcagca
cacgggaaagaagtggagttcctgctccgaatattcctcaaaatgccacacaaggacagg
aatccaaacagcagtttcaacctcaaagccctcaagggaagtctttcagaaaacgaatcc
ccaaaaagcagtttccacagatatatggatcaggggctagacattgatgccagccaactt
cagagccttctcaaccaggagtacctaacagggcccccaggggacactttctccttggac
cagtgccaaagcatcatggcactgatggatctgaaagtgaatgggcggctggatcgggag
gagtttgcaagactacagagtcgcctgatccactgccagcatgttttccagcacatccag
aggagccaaggagttctccgcagctcggacttatgggaggtcatagagagtacagacttc
ctttcaggagtcctcctcagcaaggagctgctgagtcttatgacactcaggtacagtgat
agctctggccggctcagctttcccagtcttgtctgcttcctgatacggctggaaaccatg
tcaaaggcattccgcaacctctccaaggatggcaaaagcatctacctgacagaaatggag
tggatgaagctggtcatgtacagctaa

DBGET integrated database retrieval system