KEGG   Rattus norvegicus (rat): 362713
Entry
362713            CDS       T01003                                 

Gene name
Selenoi, Ept1, RGD1560938, Seli
Definition
(RefSeq) selenoprotein I
  KO
K00993  ethanolaminephosphotransferase [EC:2.7.8.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00440  Phosphonate and phosphinate metabolism
rno00564  Glycerophospholipid metabolism
rno00565  Ether lipid metabolism
rno01100  Metabolic pathways
Module
rno_M00092  Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    362713 (Selenoi)
   00565 Ether lipid metabolism
    362713 (Selenoi)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    362713 (Selenoi)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.1  ethanolaminephosphotransferase
     362713 (Selenoi)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 362713
NCBI-ProteinID: NP_001128226
RGD: 1560938
Ensembl: ENSRNOG00000059295
UniProt: B4F7D7
Position
6q14
AA seq 398 aa
MAGYEYVSPEQLAGFDKYKYSALDTNPLSLYVMHPFWNTIVKVFPTWLAPNLITFSGFML
LVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVDGKQARRTNSSTPL
GELFDHGLDSWACVYFVVTVYSIFGRGPTGVSVFVLYLLLWVVLFSFILSHWEKYNTGVL
FLPWGYDISQVTISFVYIVTAVVGVEAWYEPFLFNFLYRDLFTAMIIGCALCVTLPMSLL
NFYRSYKSNSLKHNSIYEAMVPFFSPCLLFTLSTVWILRSPSDILEMHPRIFYFMVGTAF
ANITCQLIVCQMSSTRCPTLNWLLLPLFLVVATVIVGTTTSRLESVLLYTLTAAFTLAHI
HYGVQVVKQLSRHFQIYPFSLRKPNSDULGLEEKSIGP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggctggctacgaatacgtgagcccagagcagctggcgggctttgacaagtataagtac
agcgctttggataccaacccactctctctgtatgtcatgcacccattttggaacactata
gtgaaggtatttcccacttggctggctcccaatcttataaccttttctggctttatgctg
cttgtgttcaatttcctactcctgacatacttcgaccctgacttctatgcttcagcgcca
ggtcataagcatgtacctgattgggtctggatcgttgtgggcatcctcaacttcgttgcc
tacactctagatggagtagatggaaaacaagctcgtagaactaattccagcaccccatta
ggggagctgtttgaccacggcctggacagttgggcatgcgtttatttcgttgtgactgtg
tactctatctttggacgaggaccgactggcgtcagtgtttttgttctttacctcctgctg
tgggtggttttgttttcttttatcctgtctcactgggagaaatataacacaggcgttctt
ttcctgccatggggatatgacattagccaagtgactatttcttttgtctacatagtgact
gcggttgtgggagttgaggcctggtatgaacctttcctgtttaatttcttatatagagac
ctattcactgcaatgattattggatgtgcattgtgtgtgactcttccaatgagtttatta
aacttttatagaagctataaaagcaactctctgaagcacaattccatctatgaagccatg
gtccccttcttctctccatgcctgctcttcactctgtcgacagtgtggatcctccggtca
ccttcagatattttagaaatgcaccctagaatattctacttcatggtcggaacagctttt
gccaatatcacatgtcagctaatcgtttgccaaatgagcagcacacggtgcccaactttg
aactggttgctgcttcctctcttcttggtcgtggcaactgtgatcgtaggcacaacaacc
tcccgccttgagagtgttctcctttacacactcactgctgccttcactctggctcacatc
cattatggagtacaagtggtaaagcagctgagccgacattttcagatttatcctttttca
ttgaggaaaccaaactcagattgactaggactggaagagaagagtatcggtccgtaa

DBGET integrated database retrieval system