KEGG   Rattus norvegicus (rat): 362734
Entry
362734            CDS       T01003                                 

Gene name
Stxbp6, Amisyn
Definition
(RefSeq) syntaxin binding protein 6
  KO
K08519  syntaxin-binding protein 6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    362734 (Stxbp6)
Membrane trafficking [BR:rno04131]
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Tomosyn
    362734 (Stxbp6)
SSDB
Motif
Pfam: Sec3-PIP2_bind Synaptobrevin
Other DBs
NCBI-GeneID: 362734
NCBI-ProteinID: NP_001178801
RGD: 1306117
Ensembl: ENSRNOG00000004198
UniProt: D3ZCI5
Position
6q21
AA seq 210 aa
MSAKSAISKEIFAPLDERMLGAVQVKRRTKKKIPFLATGGQGEYLTYICLSVTNKKPTQA
SITKVKQFEGSTSFVRRSQWMLEQLRQVNGIDPNRDSAEFDLLFENAFDQWVASTASEKC
TFFQILHHTCQRYLTDRKPEFINCQSKIMGGNSILHSAADSVTSAVQKASQALNERGERL
GRAEEKTEDMKNSAQQFAETAHKLAMKHKC
NT seq 633 nt   +upstreamnt  +downstreamnt
atgagtgccaagtctgccatcagcaaggaaatttttgcacctcttgatgaaagaatgctg
ggagctgtccaagtcaagagaaggacaaagaaaaagattcctttcttggcaactgggggt
caaggcgaatatttaacttatatctgcctgtcagtgacaaacaagaaacccacacaggca
tctatcacgaaggtcaaacagtttgagggctccacatcattcgtccgaagatcccagtgg
atgcttgagcagctccgccaagttaatggtattgatcctaatcgggattctgcagagttt
gatttgttgtttgaaaatgcctttgaccagtgggttgctagcacggcctcagaaaagtgc
accttcttccagatcctccaccacacctgccagaggtacctcacagacaggaagccagag
tttattaactgccaatccaaaattatgggaggaaacagcatcctccattcagcagcggat
agtgtgaccagtgcggtacagaaggcaagccaggccttgaatgagcgaggggaacggtta
ggccgagcagaggagaagacagaagacatgaagaacagtgcccagcagtttgcagaaact
gcacacaagcttgccatgaagcacaaatgttga

DBGET integrated database retrieval system