KEGG   Rattus norvegicus (rat): 362741Help
Entry
362741            CDS       T01003                                 

Gene name
Pax9
Definition
(RefSeq) paired box 9
  KO
K09382  paired box protein 1/9
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    362741 (Pax9)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    362741 (Pax9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX HTH_23 HTH_32 HTH_29 HTH_28
Motif
Other DBs
NCBI-GeneID: 362741
NCBI-ProteinID: NP_001034628
RGD: 1560838
UniProt: Q2L4T2
Position
6q23
AA seq 342 aa AA seqDB search
MEPAFGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARY
NETGSILPGAIGGSKPRVTTPTVVKHIRTYKQRDPGIFAWEIRDRLLADGVCDKYNVPSV
SSISRILRNKIGNLAQQGHYDSYKQHQPAPQPALPYNHIYSYPSPITAAAAKVPTPPGVP
AIPGSVALPRTWPSSHSVTDILGIRSITDQGVSDSSPYHSPKVEEWSSLGRNNFSAAAPH
AVNGLEKGALEQEAKYGQAPNGLPAVSSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAG
HGWQHAGSTPLSPHNCDIPTSLAFKGMQAAREGSHSVAASAL
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggagccagccttcggggaggtgaaccagctgggaggagtgttcgtgaacggaaggccg
ctgcccaacgccattcggcttcgcatcgtggaattagcccaactgggcatccgaccttgt
gacatcagccgacagctacgggtctcgcacggctgcgtcagcaagatcttggcgcgctac
aacgagaccggttcgattttgccgggagctatcgggggaagcaagccccgggtcaccacc
cctactgtagtgaaacacatccggacttacaagcagagggacccaggcatctttgcttgg
gagatccgggaccgcctgctggcggatggcgtgtgcgacaagtacaacgtaccctctgtg
agttccatcagccggattctgcgcaacaagatcggcaacttggcccagcagggtcactac
gactcctataagcagcaccagccagcgccgcagcccgcgctgccctacaaccacatctac
tcctaccccagtcccatcacggcggcagctgctaaggtgcccacaccacctggggtgccg
gccatcccaggatccgtggccctgccgcgcacctggccctcctctcactccgtcaccgac
atcctgggcatccgttccatcaccgaccaaggagtgagcgacagctccccctaccacagc
cccaaggtggaggagtggagcagcctgggccgcaacaacttctctgctgcagccccgcac
gcagtaaatggattggagaagggagccttggagcaagaagccaagtacggccaggcaccg
aacggtctcccagctgtgagcagttttgtatcagcatccagcatggctccttaccccaca
ccagcccaagtgtcaccctacatgacctacagtgctgctccttctggttacgttgctgga
catgggtggcaacatgctggcagcactccactgtccccccacaactgtgacattcccaca
tcactggctttcaagggaatgcaggcagccagagaaggtagccattctgtcgcagcctct
gcactctga

DBGET integrated database retrieval system