KEGG   Rattus norvegicus (rat): 362757
Entry
362757            CDS       T01003                                 

Gene name
Rdh11
Definition
(RefSeq) retinol dehydrogenase 11 (all-trans/9-cis/11-cis)
  KO
K11152  retinol dehydrogenase 11 [EC:1.1.1.300]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    362757 (Rdh11)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     362757 (Rdh11)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR AdoHcyase_NAD NAD_binding_10 Epimerase
Other DBs
NCBI-GeneID: 362757
NCBI-ProteinID: NP_001012193
RGD: 1312001
Ensembl: ENSRNOG00000054770
UniProt: Q6AXX5
Position
6q24
AA seq 316 aa
MFWFPLLLSLPFILFLVTPKIRKMLSCGVCTSNVQLSGKVAIVTGANTGIGKETAKDLAR
RGARVYLACRDMQKGELVASEIQATTGNSQVLVRKLDLADTKSIRAFAEGFLAEEKYLHI
LINNAGVMMCPYSKTADGFEMHFGVNHLGHFLLTHLLLEKLKESGPSRVVNVSSLAHHLG
RIHFHNLHGEKFYSGGLAYCHSKLANILFTKELARRLKGSRVTTYSVHPGTVHSELIRHS
TALKWLWQLFFFFIKTPQQGAQTSLYCAVTEGIEGLSGSHFSDCQLAWVSSQAGNETIAR
RLWDVSCDLLGLPMDW
NT seq 951 nt   +upstreamnt  +downstreamnt
atgttttggtttccgctcctgctctctcttcccttcatcctgttcttggtcacgccgaaa
atcaggaaaatgctgtcctgtggggtgtgcacatctaacgtccagctttccgggaaggta
gccatagtcaccggtgctaacacaggcattgggaaagagacagccaaagacctggcccga
agaggagcccgtgtgtatttggcttgccgggatatgcagaagggggaactggtggctagt
gagatccaagccaccacagggaatagccaggtcctcgtacggaaactggacctagctgac
accaagtctattcgagcctttgccgaaggcttcttagctgaggaaaagtacctgcacatt
ctaatcaacaatgcaggagtgatgatgtgcccctactctaagactgcagatggctttgag
atgcactttggagtcaaccacctgggtcacttcctcttgacccatttgctgctagaaaag
ctaaaggagtcaggcccatcaagggtagtcaatgtgtcttctctggcacaccatctggga
aggatccatttccataacctgcatggcgagaagttctacagtggaggcctggcttactgc
cacagcaaactagccaacattctcttcactaaggaactggccaggaggctgaaaggctct
agagtgacaacatattctgtccatcccggcacagtccactctgaactgattcggcactcg
actgctttgaaatggctttggcagcttttcttctttttcatcaagacccctcaacaggga
gcccagacaagcctgtactgtgccgtgacagaaggtatcgagggcctaagtggaagtcat
ttcagtgactgccagttggcatgggtctctagccaagctggcaatgagacaatagccaga
cggctatgggatgtcagctgtgacctgctgggcctccctatggattggtaa

DBGET integrated database retrieval system